BLASTX nr result
ID: Ziziphus21_contig00025018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00025018 (272 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011651448.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_008447444.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_008235707.1| PREDICTED: pentatricopeptide repeat-containi... 77 7e-12 ref|XP_007200721.1| hypothetical protein PRUPE_ppa025321mg [Prun... 77 7e-12 ref|XP_009354972.1| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_006420414.1| hypothetical protein CICLE_v10006642mg [Citr... 75 2e-11 gb|KHN10981.1| Pentatricopeptide repeat-containing protein [Glyc... 74 3e-11 ref|XP_003530855.2| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_006493995.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 ref|XP_007050341.1| Basic helix-loop-helix DNA-binding superfami... 71 3e-10 ref|XP_008235792.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 ref|XP_007134299.1| hypothetical protein PHAVU_010G035600g [Phas... 70 6e-10 ref|XP_002282675.3| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 emb|CBI20254.3| unnamed protein product [Vitis vinifera] 70 8e-10 ref|XP_010098470.1| hypothetical protein L484_025905 [Morus nota... 69 1e-09 ref|XP_010052252.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_012085856.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 gb|KCW76194.1| hypothetical protein EUGRSUZ_D00581 [Eucalyptus g... 68 3e-09 ref|XP_011024802.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_006409153.1| hypothetical protein EUTSA_v10022616mg [Eutr... 67 7e-09 >ref|XP_011651448.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Cucumis sativus] gi|778681059|ref|XP_011651449.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Cucumis sativus] gi|778681062|ref|XP_011651450.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Cucumis sativus] gi|700202799|gb|KGN57932.1| hypothetical protein Csa_3G395920 [Cucumis sativus] Length = 600 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LFEEMPERN ATWNTM+DGY LGN+ES ELLF QMPT DIISWTT+ Sbjct: 226 LFEEMPERNTATWNTMIDGYARLGNVESAELLFNQMPTKDIISWTTM 272 >ref|XP_008447444.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Cucumis melo] Length = 599 Score = 82.4 bits (202), Expect = 1e-13 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LFEEMPERN ATWNTM+DGY LGN+ES ELLF QMPT DIISWTT+ Sbjct: 225 LFEEMPERNTATWNTMIDGYARLGNVESAELLFNQMPTKDIISWTTM 271 >ref|XP_008235707.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Prunus mume] Length = 583 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EM ERNI TWNTM+DGY LGN+ES ELLF MPT DIISWTT+ Sbjct: 218 LFDEMEERNITTWNTMIDGYARLGNVESAELLFNHMPTRDIISWTTM 264 >ref|XP_007200721.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica] gi|462396121|gb|EMJ01920.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica] Length = 529 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EM ERNI TWNTM+DGY LGN+ES ELLF MPT DIISWTT+ Sbjct: 164 LFDEMEERNITTWNTMIDGYARLGNVESAELLFNHMPTRDIISWTTM 210 >ref|XP_009354972.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Pyrus x bretschneideri] Length = 579 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EM E+N ATWNTM+DGY LG++ES ELLF QMPT DIISWTT+ Sbjct: 214 LFDEMTEKNAATWNTMIDGYARLGDVESAELLFNQMPTRDIISWTTM 260 >ref|XP_006420414.1| hypothetical protein CICLE_v10006642mg [Citrus clementina] gi|557522287|gb|ESR33654.1| hypothetical protein CICLE_v10006642mg [Citrus clementina] Length = 530 Score = 75.1 bits (183), Expect = 2e-11 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPERNIATWNTM+D Y LGN+++ ELLF +MP DIISWTT+ Sbjct: 165 LFDEMPERNIATWNTMIDAYARLGNVQAAELLFNKMPARDIISWTTM 211 >gb|KHN10981.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 529 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPE+N+ATWN M+DGY LGN ES E LF QMP DIISWTT+ Sbjct: 164 LFDEMPEKNVATWNAMIDGYGKLGNAESAEFLFNQMPARDIISWTTM 210 >ref|XP_003530855.2| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Glycine max] gi|947098083|gb|KRH46668.1| hypothetical protein GLYMA_08G349800 [Glycine max] Length = 585 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPE+N+ATWN M+DGY LGN ES E LF QMP DIISWTT+ Sbjct: 220 LFDEMPEKNVATWNAMIDGYGKLGNAESAEFLFNQMPARDIISWTTM 266 >ref|XP_006493995.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Citrus sinensis] Length = 578 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPERNIATWNTM+D Y LGN+ + ELLF +MP DIISWTT+ Sbjct: 213 LFDEMPERNIATWNTMIDAYARLGNVRAAELLFNKMPARDIISWTTM 259 >ref|XP_007050341.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] gi|508702602|gb|EOX94498.1| Basic helix-loop-helix DNA-binding superfamily protein [Theobroma cacao] Length = 600 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPERN ATWN M+DGY +G++ES EL F QMP DIISWT++ Sbjct: 234 LFDEMPERNTATWNAMIDGYARVGDVESAELFFNQMPVKDIISWTSM 280 >ref|XP_008235792.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Prunus mume] Length = 131 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+E ERNIATWNTM+DGY LGN+ES E LF PT DIISWTT+ Sbjct: 52 LFDEKKERNIATWNTMIDGYARLGNVESAEELFNHTPTKDIISWTTM 98 >ref|XP_007134299.1| hypothetical protein PHAVU_010G035600g [Phaseolus vulgaris] gi|561007344|gb|ESW06293.1| hypothetical protein PHAVU_010G035600g [Phaseolus vulgaris] Length = 558 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMPE+NIATWN M+DG+ LGN ES E LF QM DIISWTT+ Sbjct: 193 LFDEMPEKNIATWNAMIDGHAKLGNAESAEFLFNQMLARDIISWTTM 239 >ref|XP_002282675.3| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Vitis vinifera] Length = 564 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMP RN A+WN M+DGY L N+ES ELLF QMP DIISWTT+ Sbjct: 198 LFDEMPVRNTASWNAMIDGYSRLRNVESAELLFSQMPNRDIISWTTM 244 >emb|CBI20254.3| unnamed protein product [Vitis vinifera] Length = 494 Score = 69.7 bits (169), Expect = 8e-10 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+EMP RN A+WN M+DGY L N+ES ELLF QMP DIISWTT+ Sbjct: 198 LFDEMPVRNTASWNAMIDGYSRLRNVESAELLFSQMPNRDIISWTTM 244 >ref|XP_010098470.1| hypothetical protein L484_025905 [Morus notabilis] gi|587886325|gb|EXB75130.1| hypothetical protein L484_025905 [Morus notabilis] Length = 554 Score = 68.9 bits (167), Expect = 1e-09 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LFE M E+N TWN+M+DG+ LGNLES ELLF QMP D ISWTT+ Sbjct: 192 LFERMSEKNTTTWNSMIDGFARLGNLESAELLFHQMPARDTISWTTM 238 >ref|XP_010052252.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Eucalyptus grandis] Length = 565 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LFEEMPERN+A WN ++DGY LGN+E E LF +M DIISWTT+ Sbjct: 198 LFEEMPERNVAAWNALIDGYARLGNVELAESLFERMMVRDIISWTTM 244 >ref|XP_012085856.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Jatropha curcas] gi|643713891|gb|KDP26556.1| hypothetical protein JCGZ_17714 [Jatropha curcas] Length = 579 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+ MPE+N ATWNT++DGY L ++ES E LF QMP DIISWTT+ Sbjct: 214 LFDMMPEKNTATWNTLIDGYARLRDVESAEFLFNQMPVRDIISWTTM 260 >gb|KCW76194.1| hypothetical protein EUGRSUZ_D00581 [Eucalyptus grandis] Length = 550 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LFEEMPERN+A WN ++DGY LGN+E E LF +M DIISWTT+ Sbjct: 198 LFEEMPERNVAAWNALIDGYARLGNVELAESLFERMMVRDIISWTTM 244 >ref|XP_011024802.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06145-like [Populus euphratica] Length = 304 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/47 (61%), Positives = 37/47 (78%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 LF+ MP+RN+ATWNT++DGY L ++ ELLF QMP DIISWTT+ Sbjct: 139 LFDMMPDRNLATWNTLIDGYARLREVDVAELLFNQMPARDIISWTTM 185 >ref|XP_006409153.1| hypothetical protein EUTSA_v10022616mg [Eutrema salsugineum] gi|557110315|gb|ESQ50606.1| hypothetical protein EUTSA_v10022616mg [Eutrema salsugineum] Length = 578 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -2 Query: 271 LFEEMPERNIATWNTMLDGYV*LGNLESVELLFPQMPTWDIISWTTV 131 L +MPE+N+ATWN ++DGY LGN+E E LF QMP DIISWTT+ Sbjct: 214 LANQMPEKNVATWNCLIDGYTKLGNVEIAESLFNQMPVKDIISWTTM 260