BLASTX nr result
ID: Ziziphus21_contig00024839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00024839 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 95 2e-17 ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 91 3e-16 ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852... 75 2e-12 gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays su... 74 4e-11 gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays su... 74 4e-11 ref|YP_588287.1| hypothetical protein ZeamMp023 (mitochondrion) ... 74 4e-11 ref|XP_002529560.1| conserved hypothetical protein [Ricinus comm... 60 8e-07 ref|NP_001174470.1| Os05g0487600 [Oryza sativa Japonica Group] g... 58 2e-06 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/50 (90%), Positives = 45/50 (90%) Frame = +2 Query: 32 K*SVGGRCRCPGRTRLLLRLEDHWKTPGTRACRERSTLGGRASTVSPGHS 181 K SVGGRCRCPGRTRLLL LEDH PGTRACRERSTLGGRASTVSPGHS Sbjct: 45 KKSVGGRCRCPGRTRLLLTLEDHRNIPGTRACRERSTLGGRASTVSPGHS 94 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 91.3 bits (225), Expect = 3e-16 Identities = 43/46 (93%), Positives = 43/46 (93%), Gaps = 1/46 (2%) Frame = -2 Query: 248 HRGV-ARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDMLWS 114 H GV ARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDMLWS Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 >ref|XP_012575409.1| PREDICTED: uncharacterized protein LOC105852994 [Cicer arietinum] Length = 385 Score = 74.7 bits (182), Expect(2) = 2e-12 Identities = 40/65 (61%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = -1 Query: 237 CPGFSAWYPAPRVHDIYIQLCPGDTVEARPPSVLLSRHALVPGVFQWSS-SLRRSRVRPG 61 CPGFSAWYP PR+HDIYIQ G+TVEARPPSVLLSRH L + SS L+ SR R Sbjct: 108 CPGFSAWYPTPRIHDIYIQ---GNTVEARPPSVLLSRHVLELAYNRLSSMQLKGSRPRSP 164 Query: 60 HLQRP 46 + P Sbjct: 165 ESKHP 169 Score = 23.9 bits (50), Expect(2) = 2e-12 Identities = 11/14 (78%), Positives = 11/14 (78%), Gaps = 1/14 (7%) Frame = -3 Query: 265 CASDRHIG-ELPGF 227 CASDRHIG PGF Sbjct: 98 CASDRHIGVGCPGF 111 >gb|ABE98701.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|102579661|gb|ABF70941.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] Length = 163 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/44 (79%), Positives = 35/44 (79%) Frame = +2 Query: 41 VGGRCRCPGRTRLLLRLEDHWKTPGTRACRERSTLGGRASTVSP 172 V GRCRCPGRTRLLL LEDH K PGTRACRER T GGRAS P Sbjct: 49 VRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 >gb|ABE98744.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|93116158|gb|ABE98789.1| hypothetical protein (mitochondrion) [Zea mays subsp. mays] gi|413954480|gb|AFW87129.1| putative uncharacterized protein orf127 [Zea mays] Length = 159 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/44 (79%), Positives = 35/44 (79%) Frame = +2 Query: 41 VGGRCRCPGRTRLLLRLEDHWKTPGTRACRERSTLGGRASTVSP 172 V GRCRCPGRTRLLL LEDH K PGTRACRER T GGRAS P Sbjct: 49 VRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 92 >ref|YP_588287.1| hypothetical protein ZeamMp023 (mitochondrion) [Zea mays subsp. mays] gi|40795066|gb|AAR91110.1| hypothetical protein (mitochondrion) [Zea mays] Length = 127 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/44 (79%), Positives = 35/44 (79%) Frame = +2 Query: 41 VGGRCRCPGRTRLLLRLEDHWKTPGTRACRERSTLGGRASTVSP 172 V GRCRCPGRTRLLL LEDH K PGTRACRER T GGRAS P Sbjct: 17 VRGRCRCPGRTRLLLTLEDHRKKPGTRACRERRTRGGRASDQCP 60 >ref|XP_002529560.1| conserved hypothetical protein [Ricinus communis] gi|223530972|gb|EEF32829.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +2 Query: 89 LEDHWKTPGTRACRERSTLGGRASTVSPGHS 181 +EDH PGTRACRERSTLGGRASTVSPGHS Sbjct: 63 VEDHRNIPGTRACRERSTLGGRASTVSPGHS 93 >ref|NP_001174470.1| Os05g0487600 [Oryza sativa Japonica Group] gi|50511355|gb|AAT77278.1| unknown protein [Oryza sativa Japonica Group] gi|255676454|dbj|BAH93198.1| Os05g0487600 [Oryza sativa Japonica Group] Length = 47 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -2 Query: 125 MLWSRVSSSGLLALEEVVSVPDICNVLPRFIFIGKLK 15 MLWSRVSS GLLALEEVVSVPDICNVL R G+ K Sbjct: 1 MLWSRVSSCGLLALEEVVSVPDICNVLSRLFLGGQTK 37