BLASTX nr result
ID: Ziziphus21_contig00024186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00024186 (301 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103704.1| hypothetical protein L484_001891 [Morus nota... 98 3e-18 ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prun... 97 4e-18 ref|XP_008366695.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_008387666.1| PREDICTED: pentatricopeptide repeat-containi... 97 5e-18 ref|XP_011039733.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 ref|XP_012447551.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, part... 95 2e-17 ref|XP_003588753.1| PPR containing plant-like protein [Medicago ... 95 2e-17 ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 emb|CDP13497.1| unnamed protein product [Coffea canephora] 94 3e-17 ref|XP_010048219.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 gb|KCW80405.1| hypothetical protein EUGRSUZ_C01762, partial [Euc... 94 4e-17 ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Popu... 94 4e-17 ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glyc... 94 5e-17 ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containi... 94 5e-17 >ref|XP_010103704.1| hypothetical protein L484_001891 [Morus notabilis] gi|587908850|gb|EXB96783.1| hypothetical protein L484_001891 [Morus notabilis] Length = 599 Score = 97.8 bits (242), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVCSDC+SAT+FISKIYNREIVVRDRNRFHHF DG CSCKDFW Sbjct: 554 KNLRVCSDCHSATKFISKIYNREIVVRDRNRFHHFMDGLCSCKDFW 599 >ref|XP_010250083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nelumbo nucifera] Length = 631 Score = 97.4 bits (241), Expect = 4e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFKDG CSCKDFW Sbjct: 586 KNLRVCGDCHSATKFISKVYNREIVVRDRNRFHHFKDGSCSCKDFW 631 >ref|XP_008219679.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Prunus mume] Length = 606 Score = 97.4 bits (241), Expect = 4e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIYNREIVVRDRNRFHHFKDG CSC+DFW Sbjct: 561 KNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 606 >ref|XP_007225539.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] gi|462422475|gb|EMJ26738.1| hypothetical protein PRUPE_ppa026705mg [Prunus persica] Length = 484 Score = 97.4 bits (241), Expect = 4e-18 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIYNREIVVRDRNRFHHFKDG CSC+DFW Sbjct: 439 KNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKDGMCSCRDFW 484 >ref|XP_008366695.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like, partial [Malus domestica] Length = 366 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFKDG CSC+DFW Sbjct: 321 KNLRVCDDCHSATKFISKVYNREIVVRDRNRFHHFKDGMCSCRDFW 366 >ref|XP_008387666.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] Length = 595 Score = 97.1 bits (240), Expect = 5e-18 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFKDG CSC+DFW Sbjct: 550 KNLRVCDDCHSATKFISKVYNREIVVRDRNRFHHFKDGMCSCRDFW 595 >ref|XP_011039733.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Populus euphratica] Length = 630 Score = 95.5 bits (236), Expect = 1e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIYNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 585 KNLRVCDDCHSATKFISKIYNREIVVRDRNRFHHFKNGLCSCRDFW 630 >ref|XP_012447551.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Gossypium raimondii] gi|763787997|gb|KJB54993.1| hypothetical protein B456_009G057300 [Gossypium raimondii] Length = 610 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC+DC+SAT+FISKIYNREI+ RDR+RFHHFKDG CSCKDFW Sbjct: 565 KNLRVCNDCHSATKFISKIYNREIIARDRSRFHHFKDGLCSCKDFW 610 >ref|XP_006483347.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X2 [Citrus sinensis] Length = 566 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC+DC+SAT+FISKIYNREIVVRDR+RFHHFKDG CSC+DFW Sbjct: 521 KNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 566 >ref|XP_006483346.1| PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like isoform X1 [Citrus sinensis] Length = 600 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC+DC+SAT+FISKIYNREIVVRDR+RFHHFKDG CSC+DFW Sbjct: 555 KNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 600 >ref|XP_006450458.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] gi|557553684|gb|ESR63698.1| hypothetical protein CICLE_v10010438mg, partial [Citrus clementina] Length = 629 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC+DC+SAT+FISKIYNREIVVRDR+RFHHFKDG CSC+DFW Sbjct: 584 KNLRVCNDCHSATKFISKIYNREIVVRDRHRFHHFKDGSCSCRDFW 629 >ref|XP_003588753.1| PPR containing plant-like protein [Medicago truncatula] gi|355477801|gb|AES59004.1| PPR containing plant-like protein [Medicago truncatula] Length = 600 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 555 KNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 600 >ref|XP_004498663.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Cicer arietinum] Length = 609 Score = 94.7 bits (234), Expect = 2e-17 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLR+C DC+SAT+FISK+YNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 564 KNLRICEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 609 >emb|CDP13497.1| unnamed protein product [Coffea canephora] Length = 608 Score = 94.4 bits (233), Expect = 3e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC++AT+FISKIYNREIVVRDRNRFHHF DG CSCKDFW Sbjct: 563 KNLRVCEDCHTATKFISKIYNREIVVRDRNRFHHFIDGLCSCKDFW 608 >ref|XP_010048219.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Eucalyptus grandis] Length = 614 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIY+REIVVRDRNRFHHFKDG CSC DFW Sbjct: 569 KNLRVCEDCHSATKFISKIYDREIVVRDRNRFHHFKDGMCSCGDFW 614 >gb|KCW80405.1| hypothetical protein EUGRSUZ_C01762, partial [Eucalyptus grandis] Length = 576 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIY+REIVVRDRNRFHHFKDG CSC DFW Sbjct: 531 KNLRVCEDCHSATKFISKIYDREIVVRDRNRFHHFKDGMCSCGDFW 576 >ref|XP_002308660.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] gi|550337158|gb|EEE92183.2| hypothetical protein POPTR_0006s26860g [Populus trichocarpa] Length = 487 Score = 94.0 bits (232), Expect = 4e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SA++FISKIYNREIVVRDRNRFHHFK+G CSC+DFW Sbjct: 442 KNLRVCDDCHSASKFISKIYNREIVVRDRNRFHHFKNGLCSCRDFW 487 >ref|XP_004291465.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Fragaria vesca subsp. vesca] Length = 588 Score = 94.0 bits (232), Expect = 4e-17 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISKIYNREIVVRDRNRFHHFK+G CSCK FW Sbjct: 543 KNLRVCEDCHSATKFISKIYNREIVVRDRNRFHHFKNGLCSCKGFW 588 >gb|KHN33926.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 402 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFK+G CSC DFW Sbjct: 357 KNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCGDFW 402 >ref|XP_006601143.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Glycine max] gi|571538394|ref|XP_006601144.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X2 [Glycine max] gi|571538398|ref|XP_006601145.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X3 [Glycine max] gi|571538402|ref|XP_006601146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X4 [Glycine max] gi|947055695|gb|KRH05148.1| hypothetical protein GLYMA_17G209700 [Glycine max] gi|947055696|gb|KRH05149.1| hypothetical protein GLYMA_17G209700 [Glycine max] Length = 615 Score = 93.6 bits (231), Expect = 5e-17 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -3 Query: 299 KNLRVCSDCYSATQFISKIYNREIVVRDRNRFHHFKDGFCSCKDFW 162 KNLRVC DC+SAT+FISK+YNREIVVRDRNRFHHFK+G CSC DFW Sbjct: 570 KNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCGDFW 615