BLASTX nr result
ID: Ziziphus21_contig00022804
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022804 (410 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096308.1| hypothetical protein L484_021054 [Morus nota... 139 1e-30 ref|XP_007213619.1| hypothetical protein PRUPE_ppa002121mg [Prun... 114 3e-23 ref|XP_008228917.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_008389554.1| PREDICTED: pentatricopeptide repeat-containi... 111 2e-22 ref|XP_006483272.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_006438545.1| hypothetical protein CICLE_v10030848mg [Citr... 105 1e-20 ref|XP_010033877.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_004298606.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_008339956.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 gb|KDO82695.1| hypothetical protein CISIN_1g004470mg [Citrus sin... 102 1e-19 ref|XP_009360418.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 101 2e-19 ref|XP_012091977.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 gb|KCW53727.1| hypothetical protein EUGRSUZ_J02985 [Eucalyptus g... 97 6e-18 ref|XP_012847508.1| PREDICTED: pentatricopeptide repeat-containi... 96 1e-17 gb|EYU28680.1| hypothetical protein MIMGU_mgv1a019615mg [Erythra... 96 1e-17 gb|KHN13469.1| Pentatricopeptide repeat-containing protein, mito... 95 2e-17 ref|XP_007153868.1| hypothetical protein PHAVU_003G071600g [Phas... 95 2e-17 ref|XP_003530672.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 ref|XP_014510463.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_010255048.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 >ref|XP_010096308.1| hypothetical protein L484_021054 [Morus notabilis] gi|587874648|gb|EXB63783.1| hypothetical protein L484_021054 [Morus notabilis] Length = 749 Score = 139 bits (349), Expect = 1e-30 Identities = 69/97 (71%), Positives = 76/97 (78%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR IFS + L+ I H+ CLSF SNC PFF L LS+SSTN RPFPDYSPKKPT Sbjct: 1 MKRLTIFSVRCLRIISHHPCLSFGSNCSPFFFLGRNLSQVLSASSTNTRPFPDYSPKKPT 60 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I+DAEFVHHI+TTIKLRRSE LRRI+K YESKFR DH Sbjct: 61 IKDAEFVHHITTTIKLRRSEPLRRIMKPYESKFRSDH 97 >ref|XP_007213619.1| hypothetical protein PRUPE_ppa002121mg [Prunus persica] gi|462409484|gb|EMJ14818.1| hypothetical protein PRUPE_ppa002121mg [Prunus persica] Length = 713 Score = 114 bits (285), Expect = 3e-23 Identities = 61/97 (62%), Positives = 67/97 (69%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR IFS Q+ H LS A N FF +R C+ HGLSS STN RPFPDYSPK+PT Sbjct: 1 MKRLTIFSFYRFQSSSHRPFLSLAVNSSLFF-FRRCISHGLSSGSTNTRPFPDYSPKRPT 59 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I D+E V IS TIKLR SE LRRILK YES+FR DH Sbjct: 60 INDSELVQRISNTIKLRCSEPLRRILKPYESQFRSDH 96 >ref|XP_008228917.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] gi|645245521|ref|XP_008228918.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] gi|645245523|ref|XP_008228920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Prunus mume] Length = 742 Score = 111 bits (278), Expect = 2e-22 Identities = 60/97 (61%), Positives = 66/97 (68%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR IFS Q+ H LS + N FF R C+ HGLSS STN RPFPDYSPK+PT Sbjct: 1 MKRSTIFSFYCFQSSSHRPFLSLSVNSSLFF--RRCISHGLSSGSTNTRPFPDYSPKRPT 58 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I D+E V IS TIKLR SE LRRILK YES+FR DH Sbjct: 59 INDSELVQRISNTIKLRCSEPLRRILKPYESQFRSDH 95 >ref|XP_008389554.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|657994500|ref|XP_008389556.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658030953|ref|XP_008350930.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658030955|ref|XP_008350931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] Length = 749 Score = 111 bits (277), Expect = 2e-22 Identities = 59/97 (60%), Positives = 64/97 (65%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR AI S Q H CL+ N F +R CL HG+S ST+ RPFPDYSPKKPT Sbjct: 1 MKRRAILSVYCFQISYHRPCLNLGLNS-SLFVFRRCLSHGISLGSTHTRPFPDYSPKKPT 59 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I+DAE VH ISTTIKLR SE R ILK YES FR DH Sbjct: 60 IKDAELVHLISTTIKLRCSEPFRSILKPYESNFRSDH 96 >ref|XP_006483272.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X1 [Citrus sinensis] gi|568859493|ref|XP_006483273.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X2 [Citrus sinensis] gi|568859495|ref|XP_006483274.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like isoform X3 [Citrus sinensis] Length = 751 Score = 105 bits (262), Expect = 1e-20 Identities = 56/99 (56%), Positives = 66/99 (66%), Gaps = 2/99 (2%) Frame = -2 Query: 292 MKRCAIFSEKY-LQTILHNQCLSFASNCLPFFSYRSCL-YHGLSSSSTNIRPFPDYSPKK 119 MKRC IF+ + LQ H+ + +CL FF +R L + STN RPFPDYSPK+ Sbjct: 1 MKRCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKR 60 Query: 118 PTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 PTIRD+E VH IST IKLR SE LR LK +ESKFRPDH Sbjct: 61 PTIRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRPDH 99 >ref|XP_006438545.1| hypothetical protein CICLE_v10030848mg [Citrus clementina] gi|557540741|gb|ESR51785.1| hypothetical protein CICLE_v10030848mg [Citrus clementina] Length = 703 Score = 105 bits (262), Expect = 1e-20 Identities = 56/99 (56%), Positives = 66/99 (66%), Gaps = 2/99 (2%) Frame = -2 Query: 292 MKRCAIFSEKY-LQTILHNQCLSFASNCLPFFSYRSCL-YHGLSSSSTNIRPFPDYSPKK 119 MKRC IF+ + LQ H+ + +CL FF +R L + STN RPFPDYSPK+ Sbjct: 1 MKRCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKR 60 Query: 118 PTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 PTIRD+E VH IST IKLR SE LR LK +ESKFRPDH Sbjct: 61 PTIRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRPDH 99 >ref|XP_010033877.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Eucalyptus grandis] Length = 749 Score = 103 bits (258), Expect = 4e-20 Identities = 57/98 (58%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = -2 Query: 292 MKRCAIFSEKYL-QTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKP 116 MKR A +L T H ++S L FF R SS ST RPFPDYSPKKP Sbjct: 1 MKRVATSVSGHLFNTCRHQLHWEYSSISLLFFPCRCSSLRYFSSGSTTARPFPDYSPKKP 60 Query: 115 TIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 TI+D+E V+HISTTIKLRR+E L RILK YESKFRPDH Sbjct: 61 TIKDSELVYHISTTIKLRRTEPLHRILKPYESKFRPDH 98 >ref|XP_004298606.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Fragaria vesca subsp. vesca] Length = 746 Score = 103 bits (258), Expect = 4e-20 Identities = 57/97 (58%), Positives = 70/97 (72%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKRC +FS+ Q + L+ + + F +RS + + LSS ST++RPFPDYSPK+PT Sbjct: 1 MKRCTVFSDYCCQIFGYRARLNGLNGSV--FLFRS-VSNMLSSGSTDMRPFPDYSPKRPT 57 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I+DAE VH ISTTIKLRR E LRRILK YESKFR DH Sbjct: 58 IKDAELVHGISTTIKLRRFEPLRRILKHYESKFRSDH 94 >ref|XP_008339956.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658009489|ref|XP_008339957.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] gi|658009491|ref|XP_008339958.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Malus domestica] Length = 748 Score = 102 bits (254), Expect = 1e-19 Identities = 55/97 (56%), Positives = 63/97 (64%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MK AI S Q H+ CL+ A N F +R CL HG+S +T+ RPFPDYSPKKP+ Sbjct: 1 MKXRAILSVYSFQISHHHLCLNLAVNS-SLFIFRRCLSHGISLGATHTRPFPDYSPKKPS 59 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I+DAE VH ISTTIKLR SE ILK YES F DH Sbjct: 60 IKDAELVHRISTTIKLRCSEPFCSILKPYESHFXSDH 96 >gb|KDO82695.1| hypothetical protein CISIN_1g004470mg [Citrus sinensis] Length = 751 Score = 102 bits (254), Expect = 1e-19 Identities = 55/99 (55%), Positives = 65/99 (65%), Gaps = 2/99 (2%) Frame = -2 Query: 292 MKRCAIFSEKY-LQTILHNQCLSFASNCLPFFSYRSCL-YHGLSSSSTNIRPFPDYSPKK 119 MKRC IF+ + LQ H+ + +CL FF +R L + STN RPFPDYSPK+ Sbjct: 1 MKRCTIFTFYHCLQPNTHHSNVGIFPHCLRFFFFRGYLSQRSFALGSTNTRPFPDYSPKR 60 Query: 118 PTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 PTIRD+E VH IST IKLR SE LR LK +ESKFR DH Sbjct: 61 PTIRDSEIVHQISTAIKLRCSEPLRHTLKPFESKFRSDH 99 >ref|XP_009360418.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Pyrus x bretschneideri] Length = 728 Score = 101 bits (252), Expect = 2e-19 Identities = 56/97 (57%), Positives = 61/97 (62%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR AI S Q H L+ A N F +R L HG+S T+ RPFPDYSPKKP Sbjct: 1 MKRLAILSVHCFQISCHRPHLNIAVNS-SLFVFRRFLSHGISLGLTDTRPFPDYSPKKPP 59 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 I+DAE VH ISTTIKLR SE R ILK YES FR DH Sbjct: 60 IKDAELVHRISTTIKLRCSEPFRSILKPYESNFRSDH 96 >ref|XP_012091977.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|802787636|ref|XP_012091978.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|802787640|ref|XP_012091979.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Jatropha curcas] gi|643704188|gb|KDP21252.1| hypothetical protein JCGZ_21723 [Jatropha curcas] Length = 750 Score = 100 bits (250), Expect = 3e-19 Identities = 54/98 (55%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = -2 Query: 292 MKRCAI-FSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKP 116 MKRC + +S YL+ + + + L F RS SS STN RPFPDYSPKKP Sbjct: 1 MKRCVVLYSRLYLRLFSQHPFIGIPPHGLQLFVRRSLSQSLSSSRSTNTRPFPDYSPKKP 60 Query: 115 TIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 TI+++E VH IS TIKLRRSE L RILK Y+SKFR DH Sbjct: 61 TIKESELVHQISNTIKLRRSEPLGRILKPYKSKFRSDH 98 >gb|KCW53727.1| hypothetical protein EUGRSUZ_J02985 [Eucalyptus grandis] Length = 710 Score = 96.7 bits (239), Expect = 6e-18 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -2 Query: 169 SSSSTNIRPFPDYSPKKPTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 SS ST RPFPDYSPKKPTI+D+E V+HISTTIKLRR+E L RILK YESKFRPDH Sbjct: 71 SSGSTTARPFPDYSPKKPTIKDSELVYHISTTIKLRRTEPLHRILKPYESKFRPDH 126 >ref|XP_012847508.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Erythranthe guttatus] gi|848894937|ref|XP_012847509.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Erythranthe guttatus] Length = 738 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/83 (55%), Positives = 57/83 (68%) Frame = -2 Query: 250 ILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPTIRDAEFVHHISTTI 71 I+ + C S+ P CL+ S S+ +RPFPDYSPKKP+I+D+EFVHHIST I Sbjct: 6 IIPSACYKHPSSSRPHLFV--CLFSSSSFDSSGVRPFPDYSPKKPSIKDSEFVHHISTVI 63 Query: 70 KLRRSESLRRILKSYESKFRPDH 2 K RR E R+ILK +ESKFRPDH Sbjct: 64 KQRRCEPFRQILKPFESKFRPDH 86 >gb|EYU28680.1| hypothetical protein MIMGU_mgv1a019615mg [Erythranthe guttata] Length = 697 Score = 95.5 bits (236), Expect = 1e-17 Identities = 46/83 (55%), Positives = 57/83 (68%) Frame = -2 Query: 250 ILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPTIRDAEFVHHISTTI 71 I+ + C S+ P CL+ S S+ +RPFPDYSPKKP+I+D+EFVHHIST I Sbjct: 6 IIPSACYKHPSSSRPHLFV--CLFSSSSFDSSGVRPFPDYSPKKPSIKDSEFVHHISTVI 63 Query: 70 KLRRSESLRRILKSYESKFRPDH 2 K RR E R+ILK +ESKFRPDH Sbjct: 64 KQRRCEPFRQILKPFESKFRPDH 86 >gb|KHN13469.1| Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 742 Score = 95.1 bits (235), Expect = 2e-17 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 6/103 (5%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCL--PFFSY--RSCLYHGLSSS--STNIRPFPDY 131 MKR AI S + C + +C PF + R CL S+S S+N RPFPDY Sbjct: 1 MKRVAISS--------YFHCFHYHYHCHHNPFLGFGPRRCLSVKFSTSLGSSNARPFPDY 52 Query: 130 SPKKPTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 SP+KP++ D +FVHHISTTIK RR+E RRILK +ESKFRPDH Sbjct: 53 SPRKPSVTDTDFVHHISTTIKQRRAEPFRRILKPFESKFRPDH 95 >ref|XP_007153868.1| hypothetical protein PHAVU_003G071600g [Phaseolus vulgaris] gi|561027222|gb|ESW25862.1| hypothetical protein PHAVU_003G071600g [Phaseolus vulgaris] Length = 697 Score = 95.1 bits (235), Expect = 2e-17 Identities = 50/98 (51%), Positives = 64/98 (65%), Gaps = 1/98 (1%) Frame = -2 Query: 292 MKRCAIFSEKY-LQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKP 116 MKR A S + L+ HN + F CL + S S+N RPFPDYSPKKP Sbjct: 1 MKRAAFSSYFHCLRYSYHNPFMGFGPKCLN-------VKFSSSLDSSNARPFPDYSPKKP 53 Query: 115 TIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 +++D +FVHH+STTIK RRSE LRRILK +E+KF+PD+ Sbjct: 54 SVKDTDFVHHLSTTIKQRRSEPLRRILKPFEAKFKPDY 91 >ref|XP_003530672.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial-like [Glycine max] gi|947097235|gb|KRH45820.1| hypothetical protein GLYMA_08G294400 [Glycine max] Length = 742 Score = 95.1 bits (235), Expect = 2e-17 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 6/103 (5%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCL--PFFSY--RSCLYHGLSSS--STNIRPFPDY 131 MKR AI S + C + +C PF + R CL S+S S+N RPFPDY Sbjct: 1 MKRVAISS--------YFHCFHYHYHCHHNPFLGFGPRRCLSVKFSTSLGSSNARPFPDY 52 Query: 130 SPKKPTIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 SP+KP++ D +FVHHISTTIK RR+E RRILK +ESKFRPDH Sbjct: 53 SPRKPSVTDTDFVHHISTTIKQRRAEPFRRILKPFESKFRPDH 95 >ref|XP_014510463.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial [Vigna radiata var. radiata] Length = 738 Score = 94.0 bits (232), Expect = 4e-17 Identities = 49/97 (50%), Positives = 62/97 (63%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSSTNIRPFPDYSPKKPT 113 MKR I S Y + F C S + C S S+N RPFPDYSP+KP+ Sbjct: 1 MKRAVISS--YFNCFRYYDRNPFMGFCPKCLSVKFCS----SLGSSNARPFPDYSPRKPS 54 Query: 112 IRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 ++D++FVHHISTT+K RRSE LRRILK +E+KF+PDH Sbjct: 55 VKDSDFVHHISTTVKQRRSEPLRRILKPFEAKFKPDH 91 >ref|XP_010255048.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nelumbo nucifera] gi|719997290|ref|XP_010255049.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05670, mitochondrial isoform X1 [Nelumbo nucifera] Length = 750 Score = 94.0 bits (232), Expect = 4e-17 Identities = 51/98 (52%), Positives = 63/98 (64%), Gaps = 1/98 (1%) Frame = -2 Query: 292 MKRCAIFSEKYLQTILHNQCLSFASNCLPFFSYRSCLYHGLSSSS-TNIRPFPDYSPKKP 116 MKR A S + ++ L ++ N + FF + L SS + RPFPDYSPKKP Sbjct: 1 MKRYAFSSLHLRFQVPYSSHLGYSQNAVSFFFFFGSLSRNFSSVVYSGTRPFPDYSPKKP 60 Query: 115 TIRDAEFVHHISTTIKLRRSESLRRILKSYESKFRPDH 2 TIRD+EFV H+ST IK RRSE L RIL+S+ESKFR DH Sbjct: 61 TIRDSEFVLHLSTAIKQRRSEPLHRILRSFESKFRSDH 98