BLASTX nr result
ID: Ziziphus21_contig00022773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022773 (330 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111613.1| hypothetical protein L484_017639 [Morus nota... 79 1e-12 ref|XP_010087064.1| hypothetical protein L484_012309 [Morus nota... 79 1e-12 ref|XP_011098843.1| PREDICTED: phosducin-like protein 3 [Sesamum... 77 4e-12 ref|XP_008218564.1| PREDICTED: phosducin-like protein 3 [Prunus ... 77 7e-12 ref|XP_002263692.1| PREDICTED: phosducin-like protein 3 [Vitis v... 75 1e-11 ref|XP_009371682.1| PREDICTED: phosducin-like protein 3 [Pyrus x... 75 2e-11 ref|XP_009370276.1| PREDICTED: phosducin-like protein 3 [Pyrus x... 75 2e-11 ref|XP_008348001.1| PREDICTED: phosducin-like protein 3 [Malus d... 75 2e-11 ref|XP_008341328.1| PREDICTED: phosducin-like protein 3 [Malus d... 75 2e-11 ref|XP_007031788.1| Thioredoxin superfamily protein isoform 3 [T... 75 2e-11 ref|XP_007031787.1| Thioredoxin superfamily protein isoform 2, p... 75 2e-11 ref|XP_007031786.1| Thioredoxin superfamily protein isoform 1 [T... 75 2e-11 ref|XP_008459619.1| PREDICTED: phosducin-like protein 3 [Cucumis... 75 3e-11 ref|XP_012070887.1| PREDICTED: phosducin-like protein 3 [Jatroph... 75 3e-11 gb|EPS66856.1| hypothetical protein M569_07919 [Genlisea aurea] 75 3e-11 ref|XP_004146829.1| PREDICTED: phosducin-like protein 3 [Cucumis... 75 3e-11 gb|KHN19408.1| Viral IAP-associated factor like [Glycine soja] 74 3e-11 ref|XP_008231156.1| PREDICTED: phosducin-like protein 3 [Prunus ... 74 3e-11 ref|XP_002509555.1| Phosducin, putative [Ricinus communis] gi|22... 74 3e-11 ref|XP_012854050.1| PREDICTED: phosducin-like protein 3 [Erythra... 74 3e-11 >ref|XP_010111613.1| hypothetical protein L484_017639 [Morus notabilis] gi|587944921|gb|EXC31358.1| hypothetical protein L484_017639 [Morus notabilis] Length = 252 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK++KFGSIIPISGSDFVREVSQAPSDVW Sbjct: 83 RKKRLAELREAAKVAKFGSIIPISGSDFVREVSQAPSDVW 122 >ref|XP_010087064.1| hypothetical protein L484_012309 [Morus notabilis] gi|587835106|gb|EXB25882.1| hypothetical protein L484_012309 [Morus notabilis] Length = 251 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK++KFGSIIPISGSDFVREVSQAPSDVW Sbjct: 83 RKKRLAELREAAKVAKFGSIIPISGSDFVREVSQAPSDVW 122 >ref|XP_011098843.1| PREDICTED: phosducin-like protein 3 [Sesamum indicum] Length = 249 Score = 77.4 bits (189), Expect = 4e-12 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = +1 Query: 196 LEDLNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 LED RKKRLAE+REAAKI+KFGS+IPISGSDFVREVSQAP DVW Sbjct: 77 LEDY-RKKRLAEMREAAKIAKFGSVIPISGSDFVREVSQAPQDVW 120 >ref|XP_008218564.1| PREDICTED: phosducin-like protein 3 [Prunus mume] Length = 252 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/45 (82%), Positives = 43/45 (95%) Frame = +1 Query: 196 LEDLNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 LED RKKRLAELREAAK+++FGS++PISGSDFVREVSQAP+DVW Sbjct: 79 LEDY-RKKRLAELREAAKVARFGSVVPISGSDFVREVSQAPADVW 122 >ref|XP_002263692.1| PREDICTED: phosducin-like protein 3 [Vitis vinifera] gi|296090246|emb|CBI40065.3| unnamed protein product [Vitis vinifera] Length = 252 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE+REA KIS+FGS++PISGSDFVREVSQAPSDVW Sbjct: 83 RKKRLAEMREAVKISRFGSVMPISGSDFVREVSQAPSDVW 122 >ref|XP_009371682.1| PREDICTED: phosducin-like protein 3 [Pyrus x bretschneideri] Length = 252 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK+++FGS++PISGSDFVREVSQAP DVW Sbjct: 83 RKKRLAELREAAKVARFGSVVPISGSDFVREVSQAPPDVW 122 >ref|XP_009370276.1| PREDICTED: phosducin-like protein 3 [Pyrus x bretschneideri] Length = 252 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK+++FGS++PISGSDFVREVSQAP DVW Sbjct: 83 RKKRLAELREAAKVARFGSVVPISGSDFVREVSQAPPDVW 122 >ref|XP_008348001.1| PREDICTED: phosducin-like protein 3 [Malus domestica] Length = 252 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK+++FGS++PISGSDFVREVSQAP DVW Sbjct: 83 RKKRLAELREAAKVARFGSVVPISGSDFVREVSQAPPDVW 122 >ref|XP_008341328.1| PREDICTED: phosducin-like protein 3 [Malus domestica] Length = 252 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELREAAK+++FGS++PISGSDFVREVSQAP DVW Sbjct: 83 RKKRLAELREAAKVARFGSVVPISGSDFVREVSQAPPDVW 122 >ref|XP_007031788.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao] gi|508710817|gb|EOY02714.1| Thioredoxin superfamily protein isoform 3 [Theobroma cacao] Length = 197 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE+REA KISK+GS+IPISGSDFVREVSQAP DVW Sbjct: 81 RKKRLAEMREAVKISKYGSVIPISGSDFVREVSQAPQDVW 120 >ref|XP_007031787.1| Thioredoxin superfamily protein isoform 2, partial [Theobroma cacao] gi|508710816|gb|EOY02713.1| Thioredoxin superfamily protein isoform 2, partial [Theobroma cacao] Length = 203 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE+REA KISK+GS+IPISGSDFVREVSQAP DVW Sbjct: 81 RKKRLAEMREAVKISKYGSVIPISGSDFVREVSQAPQDVW 120 >ref|XP_007031786.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao] gi|508710815|gb|EOY02712.1| Thioredoxin superfamily protein isoform 1 [Theobroma cacao] Length = 251 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE+REA KISK+GS+IPISGSDFVREVSQAP DVW Sbjct: 81 RKKRLAEMREAVKISKYGSVIPISGSDFVREVSQAPQDVW 120 >ref|XP_008459619.1| PREDICTED: phosducin-like protein 3 [Cucumis melo] Length = 254 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRL E+REAAKISKFGS+ PISGSDFVREVSQAPSDVW Sbjct: 83 RKKRLMEIREAAKISKFGSVNPISGSDFVREVSQAPSDVW 122 >ref|XP_012070887.1| PREDICTED: phosducin-like protein 3 [Jatropha curcas] gi|643740730|gb|KDP46320.1| hypothetical protein JCGZ_10160 [Jatropha curcas] Length = 250 Score = 74.7 bits (182), Expect = 3e-11 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 196 LEDLNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 LED RKKRLAE+REA KIS+FGS++PISGSDFVREVSQAP DVW Sbjct: 77 LEDY-RKKRLAEMREAVKISRFGSVLPISGSDFVREVSQAPPDVW 120 >gb|EPS66856.1| hypothetical protein M569_07919 [Genlisea aurea] Length = 251 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 196 LEDLNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 LED RKKRLAE+REAAK++KFGS+IPISG+DFVR+VSQAP DVW Sbjct: 77 LEDY-RKKRLAEMREAAKVAKFGSVIPISGTDFVRQVSQAPQDVW 120 >ref|XP_004146829.1| PREDICTED: phosducin-like protein 3 [Cucumis sativus] gi|778686276|ref|XP_011652364.1| PREDICTED: phosducin-like protein 3 [Cucumis sativus] gi|778686280|ref|XP_011652365.1| PREDICTED: phosducin-like protein 3 [Cucumis sativus] gi|700204705|gb|KGN59838.1| hypothetical protein Csa_3G849940 [Cucumis sativus] Length = 254 Score = 74.7 bits (182), Expect = 3e-11 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRL E+REAAKISKFGS+ PISGSDFVREVSQAPSDVW Sbjct: 83 RKKRLMEIREAAKISKFGSVNPISGSDFVREVSQAPSDVW 122 >gb|KHN19408.1| Viral IAP-associated factor like [Glycine soja] Length = 379 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = +1 Query: 205 LNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 L +KKRLAE++EAAK+ +FGS+IPISGSDFVREVSQAPSDVW Sbjct: 211 LEKKKRLAEMQEAAKVLRFGSVIPISGSDFVREVSQAPSDVW 252 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE++EAAK+ +FGS+IPISGSDFVREVSQAPSDVW Sbjct: 79 RKKRLAEMQEAAKVLRFGSVIPISGSDFVREVSQAPSDVW 118 >ref|XP_008231156.1| PREDICTED: phosducin-like protein 3 [Prunus mume] Length = 252 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAELRE AK+++FGS++PISGSDFVREVSQAP+DVW Sbjct: 83 RKKRLAELRETAKVARFGSVVPISGSDFVREVSQAPADVW 122 >ref|XP_002509555.1| Phosducin, putative [Ricinus communis] gi|223549454|gb|EEF50942.1| Phosducin, putative [Ricinus communis] Length = 251 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = +1 Query: 211 RKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 RKKRLAE+RE AKI KFGS++PISGSDFVREVSQAPSDVW Sbjct: 81 RKKRLAEMREEAKILKFGSVLPISGSDFVREVSQAPSDVW 120 >ref|XP_012854050.1| PREDICTED: phosducin-like protein 3 [Erythranthe guttatus] gi|604304177|gb|EYU23510.1| hypothetical protein MIMGU_mgv1a012512mg [Erythranthe guttata] Length = 248 Score = 74.3 bits (181), Expect = 3e-11 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 196 LEDLNRKKRLAELREAAKISKFGSIIPISGSDFVREVSQAPSDVW 330 LED RKKRL+E+REA KI+KFGS+IPISGSDFVREVSQAP DVW Sbjct: 77 LEDY-RKKRLSEMREAVKIAKFGSLIPISGSDFVREVSQAPQDVW 120