BLASTX nr result
ID: Ziziphus21_contig00022727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022727 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 63 8e-08 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/37 (86%), Positives = 32/37 (86%) Frame = +3 Query: 249 MNIRRSKTISIKMTDAFSVLSIGSIITSHPLIFRNYR 359 M IRR KTISIKMTD FSVLSIGSIITSH LIFR YR Sbjct: 1 MTIRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37