BLASTX nr result
ID: Ziziphus21_contig00022630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022630 (308 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99552.1| unnamed protein product [Coffea canephora] 65 2e-08 gb|KNA11297.1| hypothetical protein SOVF_136490 [Spinacia oleracea] 64 4e-08 ref|XP_009338537.1| PREDICTED: monothiol glutaredoxin-S17 [Pyrus... 64 4e-08 ref|XP_008371359.1| PREDICTED: monothiol glutaredoxin-S17-like [... 64 4e-08 ref|XP_002519053.1| glutaredoxin, grx, putative [Ricinus communi... 64 6e-08 ref|XP_006449327.1| hypothetical protein CICLE_v10015059mg [Citr... 64 6e-08 ref|XP_004134708.1| PREDICTED: monothiol glutaredoxin-S17 [Cucum... 64 6e-08 ref|XP_009352928.1| PREDICTED: monothiol glutaredoxin-S17-like [... 63 1e-07 ref|XP_008383748.1| PREDICTED: monothiol glutaredoxin-S17 [Malus... 63 1e-07 ref|XP_008225087.1| PREDICTED: monothiol glutaredoxin-S17 [Prunu... 63 1e-07 ref|XP_006377345.1| thioredoxin family protein [Populus trichoca... 63 1e-07 ref|XP_004505049.1| PREDICTED: monothiol glutaredoxin-S17 [Cicer... 63 1e-07 ref|XP_007211857.1| hypothetical protein PRUPE_ppa004773mg [Prun... 63 1e-07 ref|XP_010108204.1| Monothiol glutaredoxin-S17 [Morus notabilis]... 62 1e-07 gb|KJB69508.1| hypothetical protein B456_011G027200 [Gossypium r... 62 1e-07 ref|XP_012455587.1| PREDICTED: monothiol glutaredoxin-S17 [Gossy... 62 1e-07 ref|XP_010655427.1| PREDICTED: monothiol glutaredoxin-S17 isofor... 62 1e-07 ref|XP_010655426.1| PREDICTED: monothiol glutaredoxin-S17 isofor... 62 1e-07 ref|XP_008439863.1| PREDICTED: monothiol glutaredoxin-S17 [Cucum... 62 1e-07 ref|XP_012091592.1| PREDICTED: monothiol glutaredoxin-S17 [Jatro... 62 1e-07 >emb|CDO99552.1| unnamed protein product [Coffea canephora] Length = 490 Score = 65.5 bits (158), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI+LELKSNGELKSTLSE Sbjct: 460 PQLYYKGELIGGCDIILELKSNGELKSTLSE 490 >gb|KNA11297.1| hypothetical protein SOVF_136490 [Spinacia oleracea] Length = 450 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGEL+GGCDI+LELK+NGELKSTLSE Sbjct: 420 PQLYYKGELVGGCDIILELKNNGELKSTLSE 450 >ref|XP_009338537.1| PREDICTED: monothiol glutaredoxin-S17 [Pyrus x bretschneideri] Length = 492 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELKSNGELKSTL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKSNGELKSTLTE 492 >ref|XP_008371359.1| PREDICTED: monothiol glutaredoxin-S17-like [Malus domestica] Length = 492 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELKSNGELKSTL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKSNGELKSTLTE 492 >ref|XP_002519053.1| glutaredoxin, grx, putative [Ricinus communis] gi|223541716|gb|EEF43264.1| glutaredoxin, grx, putative [Ricinus communis] Length = 492 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI++ELK+NGELKSTLSE Sbjct: 462 PQLYYKGELIGGCDIIMELKNNGELKSTLSE 492 >ref|XP_006449327.1| hypothetical protein CICLE_v10015059mg [Citrus clementina] gi|557551938|gb|ESR62567.1| hypothetical protein CICLE_v10015059mg [Citrus clementina] Length = 486 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELK NGELKSTLSE Sbjct: 456 PQLYYKGELIGGCDIVMELKDNGELKSTLSE 486 >ref|XP_004134708.1| PREDICTED: monothiol glutaredoxin-S17 [Cucumis sativus] gi|700194018|gb|KGN49222.1| hypothetical protein Csa_6G517300 [Cucumis sativus] Length = 490 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKG+LIGGCDIVLELKSNGELK+TLSE Sbjct: 460 PQLYYKGDLIGGCDIVLELKSNGELKATLSE 490 >ref|XP_009352928.1| PREDICTED: monothiol glutaredoxin-S17-like [Pyrus x bretschneideri] Length = 492 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELKSNGELK+TL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKSNGELKATLTE 492 >ref|XP_008383748.1| PREDICTED: monothiol glutaredoxin-S17 [Malus domestica] Length = 492 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELKSNGELK+TL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKSNGELKATLTE 492 >ref|XP_008225087.1| PREDICTED: monothiol glutaredoxin-S17 [Prunus mume] Length = 492 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELK+NGELKSTL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKNNGELKSTLTE 492 >ref|XP_006377345.1| thioredoxin family protein [Populus trichocarpa] gi|550327633|gb|ERP55142.1| thioredoxin family protein [Populus trichocarpa] Length = 454 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI+LEL+ NGELKSTLSE Sbjct: 424 PQLYYKGELIGGCDIILELRDNGELKSTLSE 454 >ref|XP_004505049.1| PREDICTED: monothiol glutaredoxin-S17 [Cicer arietinum] Length = 490 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYK ELIGGCDIV+ELKSNGELKSTLSE Sbjct: 460 PQLYYKSELIGGCDIVMELKSNGELKSTLSE 490 >ref|XP_007211857.1| hypothetical protein PRUPE_ppa004773mg [Prunus persica] gi|462407722|gb|EMJ13056.1| hypothetical protein PRUPE_ppa004773mg [Prunus persica] Length = 492 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIV+ELK+NGELKSTL+E Sbjct: 462 PQLYYKGELIGGCDIVMELKNNGELKSTLTE 492 >ref|XP_010108204.1| Monothiol glutaredoxin-S17 [Morus notabilis] gi|587931030|gb|EXC18129.1| Monothiol glutaredoxin-S17 [Morus notabilis] Length = 494 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI+LELK+NGELKSTL+E Sbjct: 464 PQLYYKGELIGGCDILLELKNNGELKSTLTE 494 >gb|KJB69508.1| hypothetical protein B456_011G027200 [Gossypium raimondii] Length = 439 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIVLEL++NGELK+TLSE Sbjct: 409 PQLYYKGELIGGCDIVLELRNNGELKATLSE 439 >ref|XP_012455587.1| PREDICTED: monothiol glutaredoxin-S17 [Gossypium raimondii] gi|763802569|gb|KJB69507.1| hypothetical protein B456_011G027200 [Gossypium raimondii] gi|763802571|gb|KJB69509.1| hypothetical protein B456_011G027200 [Gossypium raimondii] Length = 489 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDIVLEL++NGELK+TLSE Sbjct: 459 PQLYYKGELIGGCDIVLELRNNGELKATLSE 489 >ref|XP_010655427.1| PREDICTED: monothiol glutaredoxin-S17 isoform X2 [Vitis vinifera] Length = 467 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI++EL++NGELKSTLSE Sbjct: 437 PQLYYKGELIGGCDIIMELRNNGELKSTLSE 467 >ref|XP_010655426.1| PREDICTED: monothiol glutaredoxin-S17 isoform X1 [Vitis vinifera] Length = 492 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGELIGGCDI++EL++NGELKSTLSE Sbjct: 462 PQLYYKGELIGGCDIIMELRNNGELKSTLSE 492 >ref|XP_008439863.1| PREDICTED: monothiol glutaredoxin-S17 [Cucumis melo] Length = 490 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKG+LIGGCDIVLELK+NGELK+TLSE Sbjct: 460 PQLYYKGDLIGGCDIVLELKNNGELKATLSE 490 >ref|XP_012091592.1| PREDICTED: monothiol glutaredoxin-S17 [Jatropha curcas] gi|643703896|gb|KDP20960.1| hypothetical protein JCGZ_21431 [Jatropha curcas] Length = 492 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 308 PQLYYKGELIGGCDIVLELKSNGELKSTLSE 216 PQLYYKGEL+GGCDIV+EL++NGELKSTLSE Sbjct: 462 PQLYYKGELVGGCDIVMELRNNGELKSTLSE 492