BLASTX nr result
ID: Ziziphus21_contig00022486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022486 (631 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis ... 87 1e-14 gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 79 3e-12 emb|CBI21459.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_007159454.1| hypothetical protein PHAVU_002G239000g, part... 60 1e-06 >ref|YP_358581.1| hypothetical protein PhapfoPp032 [Phalaenopsis aphrodite subsp. formosana] gi|58802836|gb|AAW82556.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 103 Score = 86.7 bits (213), Expect = 1e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +2 Query: 2 AIRTRTVDLLGKTDQTYYYQNDLNCFKDPTCIFVHWALSLTDINI 136 AIRTRTVDLLGKT++TYYY+NDLNCFKDPTCI +HWALS TD+ I Sbjct: 58 AIRTRTVDLLGKTEKTYYYRNDLNCFKDPTCILLHWALSSTDVKI 102 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 78.6 bits (192), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 8 RTRTVDLLGKTDQTYYYQNDLNCFKDPTCIFVHWALSLTDINI 136 R RTVDLLGKTDQT YY+ND NCFKDPTCIF+HWALS T++ I Sbjct: 10 RIRTVDLLGKTDQTDYYRNDSNCFKDPTCIFLHWALSSTNVKI 52 >emb|CBI21459.3| unnamed protein product [Vitis vinifera] Length = 79 Score = 71.2 bits (173), Expect(2) = 1e-10 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 2 AIRTRTVDLLGKTDQTYYYQNDLNCFKDPTCIF 100 AIRTRTVDLLGKTDQT YYQNDLNCFKDPTCIF Sbjct: 39 AIRTRTVDLLGKTDQTDYYQNDLNCFKDPTCIF 71 Score = 21.9 bits (45), Expect(2) = 1e-10 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 76 FQRPNMHFCALGSFVN 123 F+ P F ALGSF+N Sbjct: 64 FKDPTCIFFALGSFIN 79 >ref|XP_007159454.1| hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] gi|561032869|gb|ESW31448.1| hypothetical protein PHAVU_002G239000g, partial [Phaseolus vulgaris] Length = 53 Score = 60.1 bits (144), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 2 AIRTRTVDLLGKTDQTYYYQNDLNCFKDPTCIFV 103 AIRTRTVDLLGKT +T+YY ND NCF +PTCIF+ Sbjct: 13 AIRTRTVDLLGKTAKTHYYLNDFNCFLNPTCIFL 46