BLASTX nr result
ID: Ziziphus21_contig00022466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022466 (618 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO86738.1| hypothetical protein CISIN_1g022784mg [Citrus sin... 57 6e-06 >gb|KDO86738.1| hypothetical protein CISIN_1g022784mg [Citrus sinensis] Length = 248 Score = 57.4 bits (137), Expect = 6e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 617 RDIEFKMIEGDFQIFVGKWSIEQVTFYCFVVV 522 RDIEFKMIEGDFQ+F GKWSIEQVT+ C ++ Sbjct: 202 RDIEFKMIEGDFQLFEGKWSIEQVTYSCLQII 233