BLASTX nr result
ID: Ziziphus21_contig00022358
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022358 (525 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103451.1| BTB/POZ and MATH domain-containing protein 2... 66 1e-08 ref|XP_004134158.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 1e-08 gb|KOM34988.1| hypothetical protein LR48_Vigan02g113800 [Vigna a... 65 2e-08 ref|XP_009347696.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 2e-08 ref|XP_008355456.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 2e-08 ref|XP_008368872.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 2e-08 ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 2e-08 ref|XP_008223027.1| PREDICTED: BTB/POZ and MATH domain-containin... 65 2e-08 ref|XP_007222747.1| hypothetical protein PRUPE_ppa006500mg [Prun... 65 2e-08 ref|XP_004296996.1| PREDICTED: BTB/POZ and MATH domain-containin... 64 3e-08 ref|XP_012569297.1| PREDICTED: BTB/POZ and MATH domain-containin... 64 4e-08 ref|XP_006380053.1| hypothetical protein POPTR_0008s20510g [Popu... 64 4e-08 ref|XP_006380052.1| hypothetical protein POPTR_0008s20510g [Popu... 64 4e-08 ref|XP_014513866.1| PREDICTED: BTB/POZ and MATH domain-containin... 64 6e-08 ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containin... 64 6e-08 ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citr... 64 6e-08 gb|AFK40364.1| unknown [Medicago truncatula] 64 6e-08 ref|XP_003590693.1| BTB/POZ/MATH-domain protein [Medicago trunca... 64 6e-08 ref|XP_010524788.1| PREDICTED: BTB/POZ and MATH domain-containin... 63 7e-08 ref|XP_010524787.1| PREDICTED: BTB/POZ and MATH domain-containin... 63 7e-08 >ref|XP_010103451.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis] gi|587907870|gb|EXB95854.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis] Length = 412 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGPLKDKNTRCIK+ED+E PVFK Sbjct: 229 RSPVFRAQLFGPLKDKNTRCIKIEDMEAPVFK 260 >ref|XP_004134158.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Cucumis sativus] gi|700201899|gb|KGN57032.1| hypothetical protein Csa_3G150120 [Cucumis sativus] Length = 408 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGPLKDK+TRCIKVEDIE PVFK Sbjct: 225 RSPVFRAQLFGPLKDKDTRCIKVEDIEAPVFK 256 >gb|KOM34988.1| hypothetical protein LR48_Vigan02g113800 [Vigna angularis] Length = 261 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGP+KD+NTRCIK+ED+E PVFKV Sbjct: 229 RSPVFRAQLFGPMKDQNTRCIKIEDMEAPVFKV 261 >ref|XP_009347696.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Pyrus x bretschneideri] Length = 410 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIKVEDIE PVFK Sbjct: 228 RSPVFRAQLFGPMKDQNTRCIKVEDIEAPVFK 259 >ref|XP_008355456.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Malus domestica] Length = 410 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIKVEDIE PVFK Sbjct: 228 RSPVFRAQLFGPMKDQNTRCIKVEDIEAPVFK 259 >ref|XP_008368872.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Malus domestica] Length = 410 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIKVEDIE PVFK Sbjct: 228 RSPVFRAQLFGPMKDQNTRCIKVEDIEAPVFK 259 >ref|XP_008235067.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Prunus mume] Length = 357 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIKVEDIE PVFK Sbjct: 175 RSPVFRAQLFGPMKDQNTRCIKVEDIEAPVFK 206 >ref|XP_008223027.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 [Prunus mume] Length = 409 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGPLKDK+T CIKVEDIEVPVFK Sbjct: 225 RSPVFRAQLFGPLKDKSTHCIKVEDIEVPVFK 256 >ref|XP_007222747.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica] gi|462419683|gb|EMJ23946.1| hypothetical protein PRUPE_ppa006500mg [Prunus persica] Length = 409 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGPLKDK+T CIKVEDIEVPVFK Sbjct: 225 RSPVFRAQLFGPLKDKSTHCIKVEDIEVPVFK 256 >ref|XP_004296996.1| PREDICTED: BTB/POZ and MATH domain-containing protein 1 [Fragaria vesca subsp. vesca] Length = 409 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGPLKDKN+ CIKVEDIE PVFKV Sbjct: 223 RSPVFRAQLFGPLKDKNSCCIKVEDIEAPVFKV 255 >ref|XP_012569297.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Cicer arietinum] Length = 410 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIKVED+E PVFK Sbjct: 228 RSPVFRAQLFGPMKDQNTRCIKVEDMEAPVFK 259 >ref|XP_006380053.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] gi|550333542|gb|ERP57850.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] Length = 325 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGP+KD+NT+CIKVED+E PVFKV Sbjct: 228 RSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKV 260 >ref|XP_006380052.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] gi|550333541|gb|ERP57849.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] Length = 285 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGP+KD+NT+CIKVED+E PVFKV Sbjct: 228 RSPVFRAQLFGPMKDQNTQCIKVEDMEAPVFKV 260 >ref|XP_014513866.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vigna radiata var. radiata] Length = 411 Score = 63.5 bits (153), Expect = 6e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NTRCIK+ED+E PVFK Sbjct: 229 RSPVFRAQLFGPMKDQNTRCIKIEDMEAPVFK 260 >ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|641856084|gb|KDO74864.1| hypothetical protein CISIN_1g015649mg [Citrus sinensis] Length = 403 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVF+AQLFGPLKD+NT+CIKVED+EVPVFK Sbjct: 220 RSPVFKAQLFGPLKDQNTQCIKVEDMEVPVFK 251 >ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] gi|557521655|gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] Length = 403 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVF+AQLFGPLKD+NT+CIKVED+EVPVFK Sbjct: 220 RSPVFKAQLFGPLKDQNTQCIKVEDMEVPVFK 251 >gb|AFK40364.1| unknown [Medicago truncatula] Length = 418 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NT+CIKVEDIE PVFK Sbjct: 232 RSPVFRAQLFGPMKDQNTQCIKVEDIEAPVFK 263 >ref|XP_003590693.1| BTB/POZ/MATH-domain protein [Medicago truncatula] gi|355479741|gb|AES60944.1| BTB/POZ/MATH-domain protein [Medicago truncatula] Length = 418 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFK 98 RSPVFRAQLFGP+KD+NT+CIKVEDIE PVFK Sbjct: 232 RSPVFRAQLFGPMKDQNTQCIKVEDIEAPVFK 263 >ref|XP_010524788.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform X2 [Tarenaya hassleriana] Length = 407 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGPLKD+NT+CIK++D+E P+FKV Sbjct: 223 RSPVFRAQLFGPLKDRNTQCIKIDDMEAPIFKV 255 >ref|XP_010524787.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform X1 [Tarenaya hassleriana] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 3 RSPVFRAQLFGPLKDKNTRCIKVEDIEVPVFKV 101 RSPVFRAQLFGPLKD+NT+CIK++D+E P+FKV Sbjct: 223 RSPVFRAQLFGPLKDRNTQCIKIDDMEAPIFKV 255