BLASTX nr result
ID: Ziziphus21_contig00022190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022190 (260 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007148474.1| hypothetical protein PHAVU_006G211700g [Phas... 60 5e-07 >ref|XP_007148474.1| hypothetical protein PHAVU_006G211700g [Phaseolus vulgaris] gi|561021697|gb|ESW20468.1| hypothetical protein PHAVU_006G211700g [Phaseolus vulgaris] Length = 292 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 259 KLCKFIRLFLILVQKCPYSHFIQTKISFCSCA 164 +L FIRLFLILVQKCPYSHFIQTKISF SCA Sbjct: 260 RLSNFIRLFLILVQKCPYSHFIQTKISFYSCA 291