BLASTX nr result
ID: Ziziphus21_contig00022106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022106 (548 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604030.1| peptidyl-prolyl cis-trans isomerase [Medicag... 67 4e-09 dbj|BAQ21277.1| cyclophilin [Citrus tamurana] 67 7e-09 ref|NP_001276071.1| uncharacterized protein LOC102623101 [Citrus... 67 7e-09 pdb|4JJM|A Chain A, Structure Of A Cyclophilin From Citrus Sinen... 67 7e-09 ref|XP_010487975.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 66 9e-09 ref|XP_010468347.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 66 9e-09 gb|KRH24153.1| hypothetical protein GLYMA_12G024700 [Glycine max] 66 1e-08 gb|KHN32305.1| Peptidyl-prolyl cis-trans isomerase 1 [Glycine soja] 66 1e-08 gb|KOM42262.1| hypothetical protein LR48_Vigan04g246000 [Vigna a... 65 2e-08 gb|KKA79871.1| hypothetical protein PRIPAC_3219 [Pristionchus pa... 65 2e-08 ref|XP_011074689.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_010420631.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_010420617.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_012460999.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 2e-08 ref|XP_002883469.1| hypothetical protein ARALYDRAFT_898931 [Arab... 65 2e-08 gb|ABL67655.1| putative cyclophilin [Citrus hybrid cultivar] 65 2e-08 gb|AAS20994.1| cyclophilin [Hyacinthus orientalis] 65 2e-08 ref|XP_010548088.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 3e-08 ref|XP_009109975.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 65 3e-08 ref|XP_014501851.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 3e-08 >ref|XP_003604030.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|355493078|gb|AES74281.1| peptidyl-prolyl cis-trans isomerase [Medicago truncatula] gi|388516727|gb|AFK46425.1| unknown [Medicago truncatula] Length = 191 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+T+GDEP GR+VMEL+AD TPLTA+NFR Sbjct: 10 PNPKVFFDMTVGDEPVGRIVMELYADTTPLTADNFR 45 >dbj|BAQ21277.1| cyclophilin [Citrus tamurana] Length = 172 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+T+G +PAGR+VMELFADVTP TAENFR Sbjct: 2 PNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFR 37 >ref|NP_001276071.1| uncharacterized protein LOC102623101 [Citrus sinensis] gi|567861906|ref|XP_006423607.1| hypothetical protein CICLE_v10029386mg [Citrus clementina] gi|260401128|gb|ACX37092.1| cyclophilin [Citrus sinensis] gi|557525541|gb|ESR36847.1| hypothetical protein CICLE_v10029386mg [Citrus clementina] Length = 172 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+T+G +PAGR+VMELFADVTP TAENFR Sbjct: 2 PNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFR 37 >pdb|4JJM|A Chain A, Structure Of A Cyclophilin From Citrus Sinensis (cscyp) In Complex With Cycloporin A gi|512125699|pdb|4JJM|B Chain B, Structure Of A Cyclophilin From Citrus Sinensis (cscyp) In Complex With Cycloporin A Length = 175 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+T+G +PAGR+VMELFADVTP TAENFR Sbjct: 5 PNPKVFFDMTVGGQPAGRIVMELFADVTPRTAENFR 40 >ref|XP_010487975.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Camelina sativa] Length = 252 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -1 Query: 158 ELLLKTPDLCEASLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 E K PD SL T NP+VF D+T+G +PAGR+VMELFAD TP TAENFR Sbjct: 67 ETTSKFPD---PSLKTANPRVFFDMTVGGKPAGRIVMELFADTTPRTAENFR 115 >ref|XP_010468347.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Camelina sativa] Length = 202 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/52 (63%), Positives = 38/52 (73%) Frame = -1 Query: 158 ELLLKTPDLCEASLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 E K PD SL T NP+VF D+T+G +PAGR+VMELFAD TP TAENFR Sbjct: 39 ETTSKFPD---PSLKTANPRVFFDMTVGGKPAGRIVMELFADTTPRTAENFR 87 >gb|KRH24153.1| hypothetical protein GLYMA_12G024700 [Glycine max] Length = 172 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+TIG +PAGR+VMEL+ADVTP TAENFR Sbjct: 2 PNPKVFFDMTIGGQPAGRIVMELYADVTPSTAENFR 37 >gb|KHN32305.1| Peptidyl-prolyl cis-trans isomerase 1 [Glycine soja] Length = 160 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+TIG +PAGR+VMEL+ADVTP TAENFR Sbjct: 2 PNPKVFFDMTIGGQPAGRIVMELYADVTPSTAENFR 37 >gb|KOM42262.1| hypothetical protein LR48_Vigan04g246000 [Vigna angularis] Length = 172 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+TIG +PAGR+VMELFAD TP TAENFR Sbjct: 2 PNPKVFFDMTIGGQPAGRIVMELFADTTPRTAENFR 37 >gb|KKA79871.1| hypothetical protein PRIPAC_3219 [Pristionchus pacificus] Length = 186 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -1 Query: 155 LLLKTPDLCEASLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 LL + + S+ P P+VF D+TIGDEPAGR+VMELF DV P TAENFR Sbjct: 2 LLAEPLSIYSPSIIMPRPQVFFDITIGDEPAGRIVMELFNDVVPKTAENFR 52 >ref|XP_011074689.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Sesamum indicum] Length = 172 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNP+VF D+TIG +PAGRVVMELFAD TP TAENFR Sbjct: 2 PNPRVFFDITIGGQPAGRVVMELFADTTPRTAENFR 37 >ref|XP_010420631.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Camelina sativa] Length = 235 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 SL T NP+VF D+T+G +PAGR+VMELFAD TP TAENFR Sbjct: 54 SLKTANPRVFFDMTVGGKPAGRIVMELFADTTPRTAENFR 93 >ref|XP_010420617.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Camelina sativa] Length = 229 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 SLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 SL T NP+VF D+T+G +PAGR+VMELFAD TP TAENFR Sbjct: 48 SLKTANPRVFFDMTVGGKPAGRIVMELFADTTPRTAENFR 87 >ref|XP_012460999.1| PREDICTED: peptidyl-prolyl cis-trans isomerase 1-like [Gossypium raimondii] gi|763810825|gb|KJB77727.1| hypothetical protein B456_012G153100 [Gossypium raimondii] Length = 173 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 107 NPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 NPKVF +VTIG EPAGR+VMELFADVTP TAENFR Sbjct: 4 NPKVFFEVTIGGEPAGRIVMELFADVTPRTAENFR 38 >ref|XP_002883469.1| hypothetical protein ARALYDRAFT_898931 [Arabidopsis lyrata subsp. lyrata] gi|297329309|gb|EFH59728.1| hypothetical protein ARALYDRAFT_898931 [Arabidopsis lyrata subsp. lyrata] Length = 242 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/51 (56%), Positives = 40/51 (78%) Frame = -1 Query: 155 LLLKTPDLCEASLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 L+++T +L + SL NPKVF D+++G +PAGR+V+ELFA TP TAENFR Sbjct: 55 LIVETSNLTDPSLKMANPKVFFDMSVGGKPAGRIVIELFAHTTPRTAENFR 105 >gb|ABL67655.1| putative cyclophilin [Citrus hybrid cultivar] Length = 172 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNPKVF D+T+G +PAGR+VMELFA+VTP TAENFR Sbjct: 2 PNPKVFFDMTVGGQPAGRIVMELFAEVTPRTAENFR 37 >gb|AAS20994.1| cyclophilin [Hyacinthus orientalis] Length = 173 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 1/46 (2%) Frame = -1 Query: 137 DLCEASLNT-PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 D SL T PNPKVF D++IG PAGR+VMELFADVTP TAENFR Sbjct: 2 DAAATSLPTNPNPKVFFDMSIGGAPAGRIVMELFADVTPNTAENFR 47 >ref|XP_010548088.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like [Tarenaya hassleriana] Length = 172 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNP+VF D+ +GD PAGR+VMELFAD TP+TAENFR Sbjct: 2 PNPRVFFDMAVGDAPAGRIVMELFADTTPVTAENFR 37 >ref|XP_009109975.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP19-1-like [Brassica rapa] Length = 284 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -1 Query: 146 KTPDLCEASLNTPNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 + P + SL NP+VF D+T+G +PAGR+VMELFAD TP TAENFR Sbjct: 97 ENPKHSDPSLKMANPRVFFDMTVGGKPAGRIVMELFADTTPRTAENFR 144 >ref|XP_014501851.1| PREDICTED: peptidyl-prolyl cis-trans isomerase [Vigna radiata var. radiata] Length = 172 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 110 PNPKVFMDVTIGDEPAGRVVMELFADVTPLTAENFR 3 PNP+VF D+TIG +PAGR+VMELFAD TP TAENFR Sbjct: 2 PNPRVFFDMTIGGQPAGRIVMELFADTTPRTAENFR 37