BLASTX nr result
ID: Ziziphus21_contig00022029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00022029 (522 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO46441.1| hypothetical protein CISIN_1g010953mg [Citrus sin... 60 6e-07 gb|KDO46438.1| hypothetical protein CISIN_1g010953mg [Citrus sin... 60 6e-07 gb|KDO46437.1| hypothetical protein CISIN_1g010953mg [Citrus sin... 60 6e-07 ref|XP_006443126.1| hypothetical protein CICLE_v10019835mg [Citr... 60 6e-07 ref|XP_006443125.1| hypothetical protein CICLE_v10019835mg [Citr... 60 6e-07 ref|XP_012568001.1| PREDICTED: uncharacterized protein LOC101513... 58 3e-06 emb|CDP14675.1| unnamed protein product [Coffea canephora] 58 3e-06 ref|XP_002532678.1| carboxyphosphonoenolpyruvate mutase, putativ... 58 3e-06 ref|XP_010321312.1| PREDICTED: LOW QUALITY PROTEIN: petal death ... 57 4e-06 ref|XP_009785441.1| PREDICTED: petal death protein isoform X3 [N... 57 4e-06 ref|XP_009785440.1| PREDICTED: petal death protein isoform X2 [N... 57 4e-06 ref|XP_009785439.1| PREDICTED: petal death protein isoform X1 [N... 57 4e-06 ref|XP_009588298.1| PREDICTED: petal death protein-like [Nicotia... 57 4e-06 emb|CBI39149.3| unnamed protein product [Vitis vinifera] 57 4e-06 ref|XP_002301634.1| hypothetical protein POPTR_0002s23170g [Popu... 57 4e-06 ref|XP_006345779.1| PREDICTED: carboxyvinyl-carboxyphosphonate p... 57 4e-06 ref|XP_002267641.1| PREDICTED: petal death protein [Vitis vinifera] 57 4e-06 ref|XP_009382921.1| PREDICTED: petal death protein isoform X2 [M... 57 5e-06 ref|XP_009382920.1| PREDICTED: petal death protein isoform X1 [M... 57 5e-06 gb|KOM28475.1| hypothetical protein LR48_Vigan549s003000 [Vigna ... 57 7e-06 >gb|KDO46441.1| hypothetical protein CISIN_1g010953mg [Citrus sinensis] Length = 462 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPKGCGHTRGRKVVSREEAVM+IKAAVD Sbjct: 187 QVSPKGCGHTRGRKVVSREEAVMRIKAAVD 216 >gb|KDO46438.1| hypothetical protein CISIN_1g010953mg [Citrus sinensis] gi|641827249|gb|KDO46439.1| hypothetical protein CISIN_1g010953mg [Citrus sinensis] gi|641827250|gb|KDO46440.1| hypothetical protein CISIN_1g010953mg [Citrus sinensis] Length = 497 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPKGCGHTRGRKVVSREEAVM+IKAAVD Sbjct: 187 QVSPKGCGHTRGRKVVSREEAVMRIKAAVD 216 >gb|KDO46437.1| hypothetical protein CISIN_1g010953mg [Citrus sinensis] Length = 456 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPKGCGHTRGRKVVSREEAVM+IKAAVD Sbjct: 187 QVSPKGCGHTRGRKVVSREEAVMRIKAAVD 216 >ref|XP_006443126.1| hypothetical protein CICLE_v10019835mg [Citrus clementina] gi|568850335|ref|XP_006478870.1| PREDICTED: petal death protein-like isoform X1 [Citrus sinensis] gi|568850337|ref|XP_006478871.1| PREDICTED: petal death protein-like isoform X2 [Citrus sinensis] gi|568850339|ref|XP_006478872.1| PREDICTED: petal death protein-like isoform X3 [Citrus sinensis] gi|557545388|gb|ESR56366.1| hypothetical protein CICLE_v10019835mg [Citrus clementina] Length = 497 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPKGCGHTRGRKVVSREEAVM+IKAAVD Sbjct: 187 QVSPKGCGHTRGRKVVSREEAVMRIKAAVD 216 >ref|XP_006443125.1| hypothetical protein CICLE_v10019835mg [Citrus clementina] gi|568850341|ref|XP_006478873.1| PREDICTED: petal death protein-like isoform X4 [Citrus sinensis] gi|568850343|ref|XP_006478874.1| PREDICTED: petal death protein-like isoform X5 [Citrus sinensis] gi|557545387|gb|ESR56365.1| hypothetical protein CICLE_v10019835mg [Citrus clementina] Length = 456 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPKGCGHTRGRKVVSREEAVM+IKAAVD Sbjct: 187 QVSPKGCGHTRGRKVVSREEAVMRIKAAVD 216 >ref|XP_012568001.1| PREDICTED: uncharacterized protein LOC101513851 [Cicer arietinum] Length = 634 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM+IKAAVD Sbjct: 325 QVSPKACGHTRGRKVVSREEAVMRIKAAVD 354 >emb|CDP14675.1| unnamed protein product [Coffea canephora] Length = 462 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM+IKAAVD Sbjct: 190 QVSPKACGHTRGRKVVSREEAVMRIKAAVD 219 >ref|XP_002532678.1| carboxyphosphonoenolpyruvate mutase, putative [Ricinus communis] gi|223527591|gb|EEF29706.1| carboxyphosphonoenolpyruvate mutase, putative [Ricinus communis] Length = 460 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM+IKAAVD Sbjct: 191 QVSPKACGHTRGRKVVSREEAVMRIKAAVD 220 >ref|XP_010321312.1| PREDICTED: LOW QUALITY PROTEIN: petal death protein [Solanum lycopersicum] Length = 528 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 192 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 221 >ref|XP_009785441.1| PREDICTED: petal death protein isoform X3 [Nicotiana sylvestris] Length = 515 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 194 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 223 >ref|XP_009785440.1| PREDICTED: petal death protein isoform X2 [Nicotiana sylvestris] Length = 525 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 194 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 223 >ref|XP_009785439.1| PREDICTED: petal death protein isoform X1 [Nicotiana sylvestris] Length = 539 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 194 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 223 >ref|XP_009588298.1| PREDICTED: petal death protein-like [Nicotiana tomentosiformis] Length = 507 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 194 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 223 >emb|CBI39149.3| unnamed protein product [Vitis vinifera] Length = 449 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM+IKAA+D Sbjct: 141 QVSPKACGHTRGRKVVSREEAVMRIKAAID 170 >ref|XP_002301634.1| hypothetical protein POPTR_0002s23170g [Populus trichocarpa] gi|222843360|gb|EEE80907.1| hypothetical protein POPTR_0002s23170g [Populus trichocarpa] Length = 504 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 194 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 223 >ref|XP_006345779.1| PREDICTED: carboxyvinyl-carboxyphosphonate phosphorylmutase, chloroplastic-like [Solanum tuberosum] Length = 505 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEA+M+IKAAVD Sbjct: 192 QVSPKACGHTRGRKVVSREEAIMRIKAAVD 221 >ref|XP_002267641.1| PREDICTED: petal death protein [Vitis vinifera] Length = 505 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM+IKAA+D Sbjct: 197 QVSPKACGHTRGRKVVSREEAVMRIKAAID 226 >ref|XP_009382921.1| PREDICTED: petal death protein isoform X2 [Musa acuminata subsp. malaccensis] Length = 503 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM IKAA+D Sbjct: 185 QVSPKACGHTRGRKVVSREEAVMHIKAAID 214 >ref|XP_009382920.1| PREDICTED: petal death protein isoform X1 [Musa acuminata subsp. malaccensis] Length = 505 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGRKVVSREEAVM IKAA+D Sbjct: 185 QVSPKACGHTRGRKVVSREEAVMHIKAAID 214 >gb|KOM28475.1| hypothetical protein LR48_Vigan549s003000 [Vigna angularis] Length = 487 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 90 KVSPKGCGHTRGRKVVSREEAVMQIKAAVD 1 +VSPK CGHTRGR+VVSREEAVM+IKAAVD Sbjct: 170 QVSPKACGHTRGRRVVSREEAVMKIKAAVD 199