BLASTX nr result
ID: Ziziphus21_contig00021859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021859 (225 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011038066.1| PREDICTED: uncharacterized protein LOC105135... 67 5e-09 ref|XP_010053997.1| PREDICTED: uncharacterized protein LOC104442... 67 5e-09 ref|XP_006370738.1| hypothetical protein POPTR_0001s45910g [Popu... 67 5e-09 gb|ABK96103.1| unknown [Populus trichocarpa] 67 5e-09 ref|XP_006477501.1| PREDICTED: UPF0136 membrane protein At2g2624... 67 7e-09 ref|XP_011625189.1| PREDICTED: uncharacterized protein LOC184390... 66 9e-09 ref|XP_007039260.1| WAS/WASL-interacting protein family member 1... 65 2e-08 ref|XP_009360262.1| PREDICTED: uncharacterized protein LOC103950... 64 3e-08 ref|XP_008375436.1| PREDICTED: UPF0136 membrane protein At2g2624... 64 4e-08 ref|XP_008239291.1| PREDICTED: UPF0136 membrane protein At2g2624... 63 1e-07 ref|XP_007209662.1| hypothetical protein PRUPE_ppa012135mg [Prun... 63 1e-07 ref|XP_011470909.1| PREDICTED: probable receptor-like protein ki... 62 1e-07 ref|XP_012086587.1| PREDICTED: uncharacterized protein LOC105645... 62 2e-07 ref|XP_012086586.1| PREDICTED: uncharacterized protein LOC105645... 62 2e-07 gb|KJB17309.1| hypothetical protein B456_003G072100 [Gossypium r... 62 2e-07 gb|KHG07320.1| Uncharacterized protein F383_34127 [Gossypium arb... 62 2e-07 ref|XP_010661966.1| PREDICTED: probable LRR receptor-like serine... 59 1e-06 emb|CBI34647.3| unnamed protein product [Vitis vinifera] 59 1e-06 ref|XP_002317643.1| hypothetical protein POPTR_0011s15010g [Popu... 59 2e-06 ref|XP_011004392.1| PREDICTED: uncharacterized protein LOC105110... 57 4e-06 >ref|XP_011038066.1| PREDICTED: uncharacterized protein LOC105135073 [Populus euphratica] Length = 175 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+SVFGIRL AT KL+P+G LLGLS+CAL+VFI AYL+DSL Sbjct: 129 LFSSVFGIRLAATQKLIPSGLLLGLSICALAVFIAAYLQDSL 170 >ref|XP_010053997.1| PREDICTED: uncharacterized protein LOC104442312 [Eucalyptus grandis] gi|702328562|ref|XP_010053998.1| PREDICTED: uncharacterized protein LOC104442312 [Eucalyptus grandis] gi|702328568|ref|XP_010053999.1| PREDICTED: uncharacterized protein LOC104442312 [Eucalyptus grandis] Length = 182 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+SVFGIRLVAT KL PAGPLLGLSV AL+VF+ AYL+DS+ Sbjct: 141 LFSSVFGIRLVATQKLTPAGPLLGLSVLALAVFLSAYLQDSI 182 >ref|XP_006370738.1| hypothetical protein POPTR_0001s45910g [Populus trichocarpa] gi|550349978|gb|ERP67307.1| hypothetical protein POPTR_0001s45910g [Populus trichocarpa] Length = 66 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+SVFGIRL AT KL+P+G LLGLS+CAL+VFI AYL+DSL Sbjct: 20 LFSSVFGIRLAATQKLIPSGLLLGLSICALAVFIAAYLQDSL 61 >gb|ABK96103.1| unknown [Populus trichocarpa] Length = 175 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+SVFGIRL AT KL+P+G LLGLS+CAL+VFI AYL+DSL Sbjct: 129 LFSSVFGIRLAATQKLIPSGLLLGLSICALAVFIAAYLQDSL 170 >ref|XP_006477501.1| PREDICTED: UPF0136 membrane protein At2g26240-like [Citrus sinensis] gi|641815638|gb|KDO38175.1| hypothetical protein CISIN_1g042298mg [Citrus sinensis] Length = 186 Score = 66.6 bits (161), Expect = 7e-09 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDS 102 LF+SVFGIRLVAT + +PAGPLLGLS CAL+VFI AYL+DS Sbjct: 145 LFSSVFGIRLVATQRPIPAGPLLGLSTCALAVFISAYLQDS 185 >ref|XP_011625189.1| PREDICTED: uncharacterized protein LOC18439027 isoform X2 [Amborella trichopoda] Length = 164 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF++VFGIRL AT KLVPAGPLLGLSVCAL+VFI A+L D + Sbjct: 123 LFSAVFGIRLAATRKLVPAGPLLGLSVCALAVFISAFLHDRI 164 >ref|XP_007039260.1| WAS/WASL-interacting protein family member 1 [Theobroma cacao] gi|508776505|gb|EOY23761.1| WAS/WASL-interacting protein family member 1 [Theobroma cacao] Length = 177 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+SVFGIRL AT KL+PAGPLLG+S+CAL VF AYL++SL Sbjct: 136 LFSSVFGIRLAATRKLIPAGPLLGVSICALVVFTSAYLQNSL 177 >ref|XP_009360262.1| PREDICTED: uncharacterized protein LOC103950755 [Pyrus x bretschneideri] gi|694361055|ref|XP_009360303.1| PREDICTED: uncharacterized protein LOC103950788 [Pyrus x bretschneideri] Length = 185 Score = 64.3 bits (155), Expect = 3e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSLSV 93 LFA+VFGIRL AT KL PAGPLL LS+ AL+VFI AYL+DS+++ Sbjct: 141 LFAAVFGIRLAATQKLAPAGPLLALSLSALAVFISAYLKDSVTI 184 >ref|XP_008375436.1| PREDICTED: UPF0136 membrane protein At2g26240 [Malus domestica] Length = 185 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSLSV 93 LFA+VFGIRL AT KL PAGPLL LS+ AL+VFI AYL+DS+++ Sbjct: 141 LFAAVFGIRLAATRKLAPAGPLLALSLSALAVFISAYLKDSVTI 184 >ref|XP_008239291.1| PREDICTED: UPF0136 membrane protein At2g26240 [Prunus mume] Length = 182 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDS 102 LFASVFGIRL AT KL PAGPLL LS+ AL+VFI AYL+DS Sbjct: 141 LFASVFGIRLAATRKLAPAGPLLALSLSALAVFISAYLQDS 181 >ref|XP_007209662.1| hypothetical protein PRUPE_ppa012135mg [Prunus persica] gi|462405397|gb|EMJ10861.1| hypothetical protein PRUPE_ppa012135mg [Prunus persica] Length = 182 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDS 102 LFASVFGIRL AT KL PAGPLL LS+ AL+VFI AYL+DS Sbjct: 141 LFASVFGIRLAATRKLAPAGPLLALSLSALAVFISAYLQDS 181 >ref|XP_011470909.1| PREDICTED: probable receptor-like protein kinase At1g49730 [Fragaria vesca subsp. vesca] Length = 716 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSLS 96 LFASVFGIRL AT K PAGPLL LS+ AL+VFI AYL+DS++ Sbjct: 672 LFASVFGIRLAATRKFAPAGPLLALSLSALAVFITAYLQDSVT 714 >ref|XP_012086587.1| PREDICTED: uncharacterized protein LOC105645568 isoform X2 [Jatropha curcas] Length = 100 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+ VFGIRL AT KL PAGPLL LS+C+L+VF+ +Y +DSL Sbjct: 59 LFSCVFGIRLAATRKLTPAGPLLALSICSLAVFVSSYFKDSL 100 >ref|XP_012086586.1| PREDICTED: uncharacterized protein LOC105645568 isoform X1 [Jatropha curcas] gi|643711763|gb|KDP25191.1| hypothetical protein JCGZ_20347 [Jatropha curcas] Length = 176 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+ VFGIRL AT KL PAGPLL LS+C+L+VF+ +Y +DSL Sbjct: 135 LFSCVFGIRLAATRKLTPAGPLLALSICSLAVFVSSYFKDSL 176 >gb|KJB17309.1| hypothetical protein B456_003G072100 [Gossypium raimondii] Length = 128 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+ VFGIRL AT K +PAGPLLGLS+CAL VF AYL+D L Sbjct: 87 LFSCVFGIRLAATRKPIPAGPLLGLSICALVVFTSAYLQDRL 128 >gb|KHG07320.1| Uncharacterized protein F383_34127 [Gossypium arboreum] Length = 168 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRDSL 99 LF+ VFGIRL AT K +PAGPLLGLS+CAL VF AYL+D L Sbjct: 127 LFSCVFGIRLAATRKPIPAGPLLGLSICALVVFTSAYLQDRL 168 >ref|XP_010661966.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g28960 [Vitis vinifera] Length = 662 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRD 105 LF+SVFGIRL AT KLVP+G LLGLS+ AL+VFI AYL+D Sbjct: 615 LFSSVFGIRLAATRKLVPSGLLLGLSIFALTVFISAYLQD 654 >emb|CBI34647.3| unnamed protein product [Vitis vinifera] Length = 436 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYLRD 105 LF+SVFGIRL AT KLVP+G LLGLS+ AL+VFI AYL+D Sbjct: 389 LFSSVFGIRLAATRKLVPSGLLLGLSIFALTVFISAYLQD 428 >ref|XP_002317643.1| hypothetical protein POPTR_0011s15010g [Populus trichocarpa] gi|222860708|gb|EEE98255.1| hypothetical protein POPTR_0011s15010g [Populus trichocarpa] Length = 171 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYL 111 LF+SVFGIRL AT KL+P+G LL LS+CALSVFI AYL Sbjct: 129 LFSSVFGIRLAATQKLIPSGLLLVLSICALSVFISAYL 166 >ref|XP_011004392.1| PREDICTED: uncharacterized protein LOC105110889 [Populus euphratica] Length = 171 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 224 LFASVFGIRLVATSKLVPAGPLLGLSVCALSVFILAYL 111 LF+SVFGIR+ AT KL+P+G LL LS+CALSVFI AYL Sbjct: 129 LFSSVFGIRVAATQKLIPSGLLLVLSICALSVFISAYL 166