BLASTX nr result
ID: Ziziphus21_contig00021741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021741 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159428.1| hypothetical protein PHAVU_002G237100g [Phas... 86 1e-14 ref|XP_007159426.1| hypothetical protein PHAVU_002G237100g [Phas... 86 1e-14 ref|XP_007159424.1| hypothetical protein PHAVU_002G237100g [Phas... 86 1e-14 ref|XP_007159423.1| hypothetical protein PHAVU_002G237100g [Phas... 86 1e-14 ref|XP_012572281.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 84 4e-14 ref|XP_009375827.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 83 7e-14 ref|XP_009375821.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 83 7e-14 gb|KHN47981.1| Peptidyl-tRNA hydrolase, mitochondrial [Glycine s... 81 3e-13 ref|XP_008351510.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 81 3e-13 ref|XP_002283606.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 81 3e-13 ref|XP_004504315.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 80 5e-13 ref|NP_001239948.1| uncharacterized protein LOC100808506 [Glycin... 80 5e-13 ref|XP_010048081.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 80 6e-13 ref|XP_010048080.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 80 6e-13 ref|XP_010048078.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 80 6e-13 ref|XP_006288619.1| hypothetical protein CARUB_v10001929mg [Caps... 80 8e-13 ref|XP_008242285.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 79 1e-12 ref|XP_010047957.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 79 1e-12 ref|XP_010047956.1| PREDICTED: peptidyl-tRNA hydrolase, mitochon... 79 1e-12 gb|KHN06384.1| Peptidyl-tRNA hydrolase, mitochondrial [Glycine s... 79 2e-12 >ref|XP_007159428.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|593792780|ref|XP_007159429.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032843|gb|ESW31422.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032844|gb|ESW31423.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] Length = 217 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NRLSRRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MFNRLSRRCFCTLAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_007159426.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|593792776|ref|XP_007159427.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032841|gb|ESW31420.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032842|gb|ESW31421.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] Length = 212 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NRLSRRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MFNRLSRRCFCTLAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_007159424.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|593792772|ref|XP_007159425.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032839|gb|ESW31418.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032840|gb|ESW31419.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] Length = 214 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NRLSRRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MFNRLSRRCFCTLAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_007159423.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|593792782|ref|XP_007159430.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032838|gb|ESW31417.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] gi|561032845|gb|ESW31424.1| hypothetical protein PHAVU_002G237100g [Phaseolus vulgaris] Length = 215 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/40 (92%), Positives = 37/40 (92%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NRLSRRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MFNRLSRRCFCTLAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_012572281.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X2 [Cicer arietinum] Length = 217 Score = 84.0 bits (206), Expect = 4e-14 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M N LSRRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MLNTLSRRCFCTVAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_009375827.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X2 [Pyrus x bretschneideri] Length = 216 Score = 83.2 bits (204), Expect = 7e-14 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M N LSRRCFCTAAPRPWLFVGLG PGDKYKGTRHN GFE Sbjct: 1 MLNWLSRRCFCTAAPRPWLFVGLGNPGDKYKGTRHNTGFE 40 >ref|XP_009375821.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X1 [Pyrus x bretschneideri] Length = 217 Score = 83.2 bits (204), Expect = 7e-14 Identities = 36/40 (90%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M N LSRRCFCTAAPRPWLFVGLG PGDKYKGTRHN GFE Sbjct: 1 MLNWLSRRCFCTAAPRPWLFVGLGNPGDKYKGTRHNTGFE 40 >gb|KHN47981.1| Peptidyl-tRNA hydrolase, mitochondrial [Glycine soja] Length = 218 Score = 81.3 bits (199), Expect = 3e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M +RLSRRCFCT PRPWLFVGLG PGDK+KGTRHNVGFE Sbjct: 1 MLHRLSRRCFCTVTPRPWLFVGLGNPGDKFKGTRHNVGFE 40 >ref|XP_008351510.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Malus domestica] Length = 217 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M N L RRCFCTAAPRPWLFVGLG PGDKYKGTRHN GFE Sbjct: 1 MLNWLCRRCFCTAAPRPWLFVGLGNPGDKYKGTRHNTGFE 40 >ref|XP_002283606.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Vitis vinifera] gi|731393216|ref|XP_010651380.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Vitis vinifera] gi|731393218|ref|XP_010651381.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Vitis vinifera] gi|731393220|ref|XP_010651382.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial [Vitis vinifera] gi|297746470|emb|CBI16526.3| unnamed protein product [Vitis vinifera] Length = 217 Score = 81.3 bits (199), Expect = 3e-13 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NR SRR FCTA+PRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MLNRFSRRLFCTASPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_004504315.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X1 [Cicer arietinum] Length = 247 Score = 80.5 bits (197), Expect = 5e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 112 RLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 RL++RCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 34 RLNKRCFCTVAPRPWLFVGLGNPGDKYKGTRHNVGFE 70 >ref|NP_001239948.1| uncharacterized protein LOC100808506 [Glycine max] gi|571469106|ref|XP_006584596.1| PREDICTED: uncharacterized protein LOC100808506 isoform X1 [Glycine max] gi|255645293|gb|ACU23143.1| unknown [Glycine max] gi|947094250|gb|KRH42835.1| hypothetical protein GLYMA_08G114800 [Glycine max] gi|947094251|gb|KRH42836.1| hypothetical protein GLYMA_08G114800 [Glycine max] gi|947094252|gb|KRH42837.1| hypothetical protein GLYMA_08G114800 [Glycine max] Length = 218 Score = 80.5 bits (197), Expect = 5e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M +RLSRRCFCT PRPWLFVGLG PGDK+KGTRHNVGFE Sbjct: 1 MLHRLSRRCFCTFTPRPWLFVGLGNPGDKFKGTRHNVGFE 40 >ref|XP_010048081.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X3 [Eucalyptus grandis] Length = 179 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M + ++RRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MHSVIARRCFCTGAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_010048080.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X2 [Eucalyptus grandis] Length = 200 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M + ++RRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MHSVIARRCFCTGAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_010048078.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X1 [Eucalyptus grandis] gi|702295856|ref|XP_010048079.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X1 [Eucalyptus grandis] gi|629115500|gb|KCW80175.1| hypothetical protein EUGRSUZ_C01519 [Eucalyptus grandis] Length = 217 Score = 80.1 bits (196), Expect = 6e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M + ++RRCFCT APRPWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MHSVIARRCFCTGAPRPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_006288619.1| hypothetical protein CARUB_v10001929mg [Capsella rubella] gi|482557325|gb|EOA21517.1| hypothetical protein CARUB_v10001929mg [Capsella rubella] Length = 219 Score = 79.7 bits (195), Expect = 8e-13 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 115 NRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 NRLSRRC+CT+A RPWLF+GLG PGDKYKGTRHN+GFE Sbjct: 4 NRLSRRCYCTSAQRPWLFLGLGNPGDKYKGTRHNIGFE 41 >ref|XP_008242285.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X1 [Prunus mume] gi|645215046|ref|XP_008218141.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial isoform X1 [Prunus mume] Length = 218 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/40 (87%), Positives = 35/40 (87%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M NRL RR FCTAAP PWLFVGLG PGDKYKGTRHNVGFE Sbjct: 1 MLNRLGRRYFCTAAPYPWLFVGLGNPGDKYKGTRHNVGFE 40 >ref|XP_010047957.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X2 [Eucalyptus grandis] gi|629115321|gb|KCW79996.1| hypothetical protein EUGRSUZ_C01330 [Eucalyptus grandis] Length = 200 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M + ++RRCFCT APRPWLFVGLG PGDKY+GTRHNVGFE Sbjct: 1 MHSVIARRCFCTGAPRPWLFVGLGNPGDKYRGTRHNVGFE 40 >ref|XP_010047956.1| PREDICTED: peptidyl-tRNA hydrolase, mitochondrial-like isoform X1 [Eucalyptus grandis] gi|629115320|gb|KCW79995.1| hypothetical protein EUGRSUZ_C01330 [Eucalyptus grandis] Length = 217 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -3 Query: 121 MRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 M + ++RRCFCT APRPWLFVGLG PGDKY+GTRHNVGFE Sbjct: 1 MHSVIARRCFCTGAPRPWLFVGLGNPGDKYRGTRHNVGFE 40 >gb|KHN06384.1| Peptidyl-tRNA hydrolase, mitochondrial [Glycine soja] Length = 101 Score = 78.6 bits (192), Expect = 2e-12 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -3 Query: 124 EMRNRLSRRCFCTAAPRPWLFVGLGKPGDKYKGTRHNVGFE 2 +M NRL+RR FCT APRPWLFVGLG PG+K+KGTRHNVGFE Sbjct: 11 DMLNRLNRRFFCTVAPRPWLFVGLGNPGEKFKGTRHNVGFE 51