BLASTX nr result
ID: Ziziphus21_contig00021531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00021531 (227 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010107523.1| Ethylene-insensitive protein 2 [Morus notabi... 55 2e-09 >ref|XP_010107523.1| Ethylene-insensitive protein 2 [Morus notabilis] gi|587929030|gb|EXC16205.1| Ethylene-insensitive protein 2 [Morus notabilis] Length = 1306 Score = 54.7 bits (130), Expect(2) = 2e-09 Identities = 28/47 (59%), Positives = 32/47 (68%) Frame = -3 Query: 198 SGFVSSIGRNTYKQSFYEVLV*EIGAPEAFHELFPSKVYKDALSSPM 58 SGF SS+GR Y+QS Y G P AF EL PSKVY+DALS+PM Sbjct: 945 SGFGSSVGRTGYEQSMYSNSGSRTGGPLAFDELSPSKVYRDALSAPM 991 Score = 33.5 bits (75), Expect(2) = 2e-09 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -2 Query: 58 DSRFDIWLLWSRQPFEQFG 2 +S FD LWSRQPFEQFG Sbjct: 992 NSSFDTGSLWSRQPFEQFG 1010