BLASTX nr result
ID: Ziziphus21_contig00020970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020970 (310 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512882.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002512882.1| conserved hypothetical protein [Ricinus communis] gi|223547893|gb|EEF49385.1| conserved hypothetical protein [Ricinus communis] Length = 656 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 115 MKSPLAKLRRFGINKNDSKDKRDFQPSAQLDELAQAAK 2 MKSPL KLR F ++K+D+KDKRD PSAQLDELAQAA+ Sbjct: 1 MKSPLGKLRGFKLHKSDTKDKRDLLPSAQLDELAQAAE 38