BLASTX nr result
ID: Ziziphus21_contig00020928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020928 (482 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010049271.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 131 2e-28 gb|KCW81886.1| hypothetical protein EUGRSUZ_C032522, partial [Eu... 131 2e-28 gb|KCW81785.1| hypothetical protein EUGRSUZ_C031462, partial [Eu... 131 2e-28 ref|XP_002276358.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 131 2e-28 emb|CAN73679.1| hypothetical protein VITISV_021402 [Vitis vinifera] 131 2e-28 gb|KJB82905.1| hypothetical protein B456_013G226400 [Gossypium r... 130 4e-28 gb|KJB82904.1| hypothetical protein B456_013G226400 [Gossypium r... 130 4e-28 ref|XP_012464917.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 130 4e-28 ref|XP_011072565.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 130 4e-28 ref|XP_011011113.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 130 4e-28 ref|XP_011011112.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-l... 130 4e-28 ref|XP_010656148.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 i... 130 4e-28 gb|KHG14803.1| PHD finger ALFIN-LIKE 5 -like protein [Gossypium ... 130 4e-28 ref|XP_010273964.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 130 4e-28 ref|XP_010261980.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 130 4e-28 ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 130 4e-28 ref|XP_012077221.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [... 130 4e-28 ref|XP_002516111.1| DNA binding protein, putative [Ricinus commu... 130 4e-28 ref|XP_002324777.1| PHD finger family protein [Populus trichocar... 130 4e-28 ref|XP_002308535.1| PHD finger family protein [Populus trichocar... 130 4e-28 >ref|XP_010049271.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Eucalyptus grandis] Length = 128 Score = 131 bits (330), Expect = 2e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 74 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 128 >gb|KCW81886.1| hypothetical protein EUGRSUZ_C032522, partial [Eucalyptus grandis] Length = 87 Score = 131 bits (330), Expect = 2e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 33 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 87 >gb|KCW81785.1| hypothetical protein EUGRSUZ_C031462, partial [Eucalyptus grandis] Length = 133 Score = 131 bits (330), Expect = 2e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 79 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 133 >ref|XP_002276358.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Vitis vinifera] gi|297743032|emb|CBI35899.3| unnamed protein product [Vitis vinifera] Length = 261 Score = 131 bits (330), Expect = 2e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 207 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 261 >emb|CAN73679.1| hypothetical protein VITISV_021402 [Vitis vinifera] Length = 239 Score = 131 bits (330), Expect = 2e-28 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 185 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 239 >gb|KJB82905.1| hypothetical protein B456_013G226400 [Gossypium raimondii] Length = 223 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 169 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 223 >gb|KJB82904.1| hypothetical protein B456_013G226400 [Gossypium raimondii] Length = 168 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 114 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 168 >ref|XP_012464917.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Gossypium raimondii] gi|763816051|gb|KJB82903.1| hypothetical protein B456_013G226400 [Gossypium raimondii] Length = 252 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 198 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 252 >ref|XP_011072565.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like [Sesamum indicum] Length = 250 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 196 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 250 >ref|XP_011011113.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X2 [Populus euphratica] Length = 253 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 199 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 253 >ref|XP_011011112.1| PREDICTED: PHD finger protein ALFIN-LIKE 4-like isoform X1 [Populus euphratica] Length = 254 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 200 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 254 >ref|XP_010656148.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 isoform X2 [Vitis vinifera] Length = 242 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 188 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 242 >gb|KHG14803.1| PHD finger ALFIN-LIKE 5 -like protein [Gossypium arboreum] Length = 252 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 198 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 252 >ref|XP_010273964.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nelumbo nucifera] Length = 252 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 198 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 252 >ref|XP_010261980.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nelumbo nucifera] gi|720019031|ref|XP_010261981.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nelumbo nucifera] Length = 252 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 198 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 252 >ref|XP_009784316.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Nicotiana sylvestris] Length = 246 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICE+WFHGKCVKITPARAEHIKQYKCPSCSNKRSRP Sbjct: 192 LCGACGENYASDEFWICCDICERWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 246 >ref|XP_012077221.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Jatropha curcas] gi|643724850|gb|KDP34051.1| hypothetical protein JCGZ_07622 [Jatropha curcas] Length = 253 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 199 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 253 >ref|XP_002516111.1| DNA binding protein, putative [Ricinus communis] gi|223544597|gb|EEF46113.1| DNA binding protein, putative [Ricinus communis] Length = 251 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 197 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 251 >ref|XP_002324777.1| PHD finger family protein [Populus trichocarpa] gi|222866211|gb|EEF03342.1| PHD finger family protein [Populus trichocarpa] Length = 253 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 199 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 253 >ref|XP_002308535.1| PHD finger family protein [Populus trichocarpa] gi|743812867|ref|XP_011019378.1| PREDICTED: PHD finger protein ALFIN-LIKE 4 [Populus euphratica] gi|222854511|gb|EEE92058.1| PHD finger family protein [Populus trichocarpa] Length = 253 Score = 130 bits (327), Expect = 4e-28 Identities = 54/55 (98%), Positives = 55/55 (100%) Frame = -3 Query: 480 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRSRP 316 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKR+RP Sbjct: 199 LCGACGENYASDEFWICCDICEKWFHGKCVKITPARAEHIKQYKCPSCSNKRARP 253