BLASTX nr result
ID: Ziziphus21_contig00020903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020903 (502 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525601.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 >ref|XP_002525601.1| conserved hypothetical protein [Ricinus communis] gi|223535037|gb|EEF36719.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/49 (69%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 358 PVQAQKNKKERKCTLPTQALSCSGSKGLSQPDLPHS-SQTARAKQMQAP 501 PVQ QK K +RKCTLPTQALSCSGSKGLSQPDL + ++ KQ+QAP Sbjct: 23 PVQEQK-KWKRKCTLPTQALSCSGSKGLSQPDLLNPLTKWPVLKQIQAP 70