BLASTX nr result
ID: Ziziphus21_contig00020762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020762 (610 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010104577.1| hypothetical protein L484_025556 [Morus nota... 59 2e-06 >ref|XP_010104577.1| hypothetical protein L484_025556 [Morus notabilis] gi|587913361|gb|EXC01178.1| hypothetical protein L484_025556 [Morus notabilis] Length = 97 Score = 59.3 bits (142), Expect = 2e-06 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 1/99 (1%) Frame = -2 Query: 345 MEGMPSPRNTDNEXXXXXXXXXXXXLPWXXXXXXXXXXXXTKQRISRLKAVG-GFKYDPL 169 MEG+PSP++T++E LPW ++ + G GF+YDPL Sbjct: 1 MEGIPSPKSTEHEGLFSCWGCLKLKLPWKRSRITRRYTTISRGHVRSKSGTGAGFRYDPL 60 Query: 168 SYAQNXXXXXXXXXXEYTQRGFSARYAAPAPVSKSLEDK 52 SYAQN + + RGFSAR+ AP+SK L+D+ Sbjct: 61 SYAQNFDDGCDADDRDLSHRGFSARFV--APLSKPLQDE 97