BLASTX nr result
ID: Ziziphus21_contig00020663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020663 (325 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012068382.1| PREDICTED: uncharacterized protein LOC105630... 61 4e-07 >ref|XP_012068382.1| PREDICTED: uncharacterized protein LOC105630996 [Jatropha curcas] gi|643734837|gb|KDP41507.1| hypothetical protein JCGZ_15914 [Jatropha curcas] Length = 97 Score = 60.8 bits (146), Expect = 4e-07 Identities = 35/64 (54%), Positives = 42/64 (65%) Frame = -2 Query: 192 MEEIRSSESPPETHSPGTGAANPAVGSSKKGETSMASRMKKDCLAFLVSVQEGFEYVKAF 13 MEEIR+S SPP P +A K + +M SRMKK+CLAF VS+QEGF Y+KA Sbjct: 1 MEEIRASPSPPPPPPPTPTSAT-------KSKPAM-SRMKKECLAFAVSLQEGFRYMKAL 52 Query: 12 FVGQ 1 FVGQ Sbjct: 53 FVGQ 56