BLASTX nr result
ID: Ziziphus21_contig00020643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020643 (487 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citr... 60 6e-07 >ref|XP_006444234.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] gi|557546496|gb|ESR57474.1| hypothetical protein CICLE_v10023116mg [Citrus clementina] Length = 83 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 2/75 (2%) Frame = -2 Query: 447 HLLVVFSSPF-LTEKEIAGELGA*ASEMGKVVCTELSEG-NLSLMGLLMAVVIAITLLII 274 H+ FSSP L E LG+ +MGK++C+E+ + L MGLLM +V+A+TL++I Sbjct: 8 HIASAFSSPANLLETGRKAGLGSSVFDMGKLICSEIEQTFGLDFMGLLMVLVLALTLMVI 67 Query: 273 CKPPQRRRVFIVYRM 229 C PP RR + YR+ Sbjct: 68 CVPPPRRYMVTAYRV 82