BLASTX nr result
ID: Ziziphus21_contig00020285
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020285 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004293748.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 69 1e-09 ref|XP_010648756.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 67 4e-09 ref|XP_002276697.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 67 4e-09 gb|KNA14184.1| hypothetical protein SOVF_109920 [Spinacia oleracea] 67 5e-09 ref|XP_010695784.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 67 7e-09 ref|XP_012829752.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 65 2e-08 ref|XP_006468454.1| PREDICTED: phosphatase IMPL1, chloroplastic-... 65 2e-08 ref|XP_006377017.1| inositol monophosphatase family protein [Pop... 65 2e-08 ref|XP_011626601.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_011626600.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_011626599.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_011626597.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_011626595.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_011096791.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_006853338.1| PREDICTED: phosphatase IMPL1, chloroplastic ... 64 4e-08 ref|XP_008356139.1| PREDICTED: phosphatase IMPL1, chloroplastic,... 63 8e-08 ref|XP_008372106.1| PREDICTED: LOW QUALITY PROTEIN: phosphatase ... 63 8e-08 ref|XP_009353946.1| PREDICTED: phosphatase IMPL1, chloroplastic-... 63 1e-07 emb|CDP11230.1| unnamed protein product [Coffea canephora] 63 1e-07 ref|XP_006448721.1| hypothetical protein CICLE_v10015670mg [Citr... 63 1e-07 >ref|XP_004293748.1| PREDICTED: phosphatase IMPL1, chloroplastic [Fragaria vesca subsp. vesca] Length = 373 Score = 69.3 bits (168), Expect = 1e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKFC+FDRSVLVSNGVLHDK+ Sbjct: 310 EEAGGVVTCMDGGKFCIFDRSVLVSNGVLHDKL 342 >ref|XP_010648756.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis vinifera] gi|731371283|ref|XP_010648759.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis vinifera] gi|731371287|ref|XP_010648764.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis vinifera] gi|731371291|ref|XP_010648771.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Vitis vinifera] Length = 369 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKFCVFDRSVLVSNGVLH K+ Sbjct: 306 EEAGGTVTCMDGGKFCVFDRSVLVSNGVLHSKL 338 >ref|XP_002276697.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Vitis vinifera] gi|297737968|emb|CBI27169.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKFCVFDRSVLVSNGVLH K+ Sbjct: 305 EEAGGTVTCMDGGKFCVFDRSVLVSNGVLHSKL 337 >gb|KNA14184.1| hypothetical protein SOVF_109920 [Spinacia oleracea] Length = 380 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGGAVTCMDGGKFCVFDRSV+VSNG+LH K+ Sbjct: 317 EEAGGAVTCMDGGKFCVFDRSVIVSNGLLHSKL 349 >ref|XP_010695784.1| PREDICTED: phosphatase IMPL1, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870844472|gb|KMS97435.1| hypothetical protein BVRB_5g127150 [Beta vulgaris subsp. vulgaris] Length = 379 Score = 66.6 bits (161), Expect = 7e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGGAVTCMDGGKFCV+DRSVLVSNG+LH K+ Sbjct: 316 EEAGGAVTCMDGGKFCVYDRSVLVSNGLLHSKL 348 >ref|XP_012829752.1| PREDICTED: phosphatase IMPL1, chloroplastic [Erythranthe guttatus] gi|604345045|gb|EYU43684.1| hypothetical protein MIMGU_mgv1a008196mg [Erythranthe guttata] gi|604345046|gb|EYU43685.1| hypothetical protein MIMGU_mgv1a008196mg [Erythranthe guttata] Length = 381 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG V+CMDGGKFCVFDRSVLVSNGVLH K+ Sbjct: 318 EEAGGTVSCMDGGKFCVFDRSVLVSNGVLHAKL 350 >ref|XP_006468454.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X1 [Citrus sinensis] gi|568828246|ref|XP_006468455.1| PREDICTED: phosphatase IMPL1, chloroplastic-like isoform X2 [Citrus sinensis] gi|641858683|gb|KDO77405.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis] gi|641858684|gb|KDO77406.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis] gi|641858685|gb|KDO77407.1| hypothetical protein CISIN_1g017597mg [Citrus sinensis] Length = 369 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGGAV+CMDGGKFCVFDRSVLVSNG LH K+ Sbjct: 306 EEAGGAVSCMDGGKFCVFDRSVLVSNGALHAKL 338 >ref|XP_006377017.1| inositol monophosphatase family protein [Populus trichocarpa] gi|550326953|gb|ERP54814.1| inositol monophosphatase family protein [Populus trichocarpa] Length = 373 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG V+CMDGGKFCVFDRSVLVSNGVLH K+ Sbjct: 310 EEAGGTVSCMDGGKFCVFDRSVLVSNGVLHAKL 342 >ref|XP_011626601.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X6 [Amborella trichopoda] Length = 323 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 259 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 291 >ref|XP_011626600.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X5 [Amborella trichopoda] Length = 330 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 266 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 298 >ref|XP_011626599.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X4 [Amborella trichopoda] Length = 338 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 274 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 306 >ref|XP_011626597.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X3 [Amborella trichopoda] Length = 374 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 310 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 342 >ref|XP_011626595.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Amborella trichopoda] gi|769801166|ref|XP_011626596.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X1 [Amborella trichopoda] Length = 379 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 315 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 347 >ref|XP_011096791.1| PREDICTED: phosphatase IMPL1, chloroplastic [Sesamum indicum] Length = 378 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG V+CMDGGKFCVFDRSV+VSNGVLH K+ Sbjct: 315 EEAGGTVSCMDGGKFCVFDRSVVVSNGVLHAKL 347 >ref|XP_006853338.1| PREDICTED: phosphatase IMPL1, chloroplastic isoform X2 [Amborella trichopoda] gi|548856991|gb|ERN14805.1| hypothetical protein AMTR_s00032p00084330 [Amborella trichopoda] Length = 378 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG+VTCMDGG FCVFDRSVLVSNG LH K+ Sbjct: 315 EEAGGSVTCMDGGNFCVFDRSVLVSNGALHGKL 347 >ref|XP_008356139.1| PREDICTED: phosphatase IMPL1, chloroplastic, partial [Malus domestica] Length = 267 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKF VFDRSVLVSNGVLH K+ Sbjct: 204 EEAGGKVTCMDGGKFSVFDRSVLVSNGVLHGKV 236 >ref|XP_008372106.1| PREDICTED: LOW QUALITY PROTEIN: phosphatase IMPL1, chloroplastic [Malus domestica] Length = 346 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKF VFDRSVLVSNGVLH K+ Sbjct: 283 EEAGGKVTCMDGGKFSVFDRSVLVSNGVLHGKV 315 >ref|XP_009353946.1| PREDICTED: phosphatase IMPL1, chloroplastic-like [Pyrus x bretschneideri] gi|694402806|ref|XP_009376387.1| PREDICTED: phosphatase IMPL1, chloroplastic [Pyrus x bretschneideri] Length = 373 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGG VTCMDGGKF VFDRSVLVSNGVLH K+ Sbjct: 310 EEAGGKVTCMDGGKFSVFDRSVLVSNGVLHGKL 342 >emb|CDP11230.1| unnamed protein product [Coffea canephora] Length = 323 Score = 62.8 bits (151), Expect = 1e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGGAV+CMDGGKF VFDRSVLVSNGVLH K+ Sbjct: 260 EEAGGAVSCMDGGKFSVFDRSVLVSNGVLHAKL 292 >ref|XP_006448721.1| hypothetical protein CICLE_v10015670mg [Citrus clementina] gi|567912817|ref|XP_006448722.1| hypothetical protein CICLE_v10015670mg [Citrus clementina] gi|557551332|gb|ESR61961.1| hypothetical protein CICLE_v10015670mg [Citrus clementina] gi|557551333|gb|ESR61962.1| hypothetical protein CICLE_v10015670mg [Citrus clementina] Length = 369 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 EEAGGAVTCMDGGKFCVFDRSVLVSNGVLHDKI 99 EEAGGAV+CMDG KFCVFDRSVLVSNG LH K+ Sbjct: 306 EEAGGAVSCMDGSKFCVFDRSVLVSNGALHAKL 338