BLASTX nr result
ID: Ziziphus21_contig00020156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020156 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010103616.1| hypothetical protein L484_023114 [Morus nota... 134 2e-29 ref|XP_007224913.1| hypothetical protein PRUPE_ppa021912mg, part... 129 9e-28 ref|XP_008382731.1| PREDICTED: pentatricopeptide repeat-containi... 125 2e-26 ref|XP_009346026.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_008223913.1| PREDICTED: pentatricopeptide repeat-containi... 124 3e-26 ref|XP_002267326.2| PREDICTED: pentatricopeptide repeat-containi... 120 4e-25 emb|CBI28998.3| unnamed protein product [Vitis vinifera] 120 4e-25 ref|XP_011041952.1| PREDICTED: pentatricopeptide repeat-containi... 115 1e-23 ref|XP_002314200.2| hypothetical protein POPTR_0009s03250g, part... 114 3e-23 ref|XP_010931320.1| PREDICTED: pentatricopeptide repeat-containi... 105 1e-20 ref|XP_008792261.1| PREDICTED: putative pentatricopeptide repeat... 104 3e-20 gb|KDO69875.1| hypothetical protein CISIN_1g0362902mg, partial [... 103 4e-20 ref|XP_006484505.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_006484504.1| PREDICTED: pentatricopeptide repeat-containi... 103 4e-20 ref|XP_006437631.1| hypothetical protein CICLE_v10030859mg [Citr... 103 4e-20 ref|XP_010031940.1| PREDICTED: pentatricopeptide repeat-containi... 100 6e-19 gb|KCW51340.1| hypothetical protein EUGRSUZ_J00891 [Eucalyptus g... 100 6e-19 ref|XP_002441698.1| hypothetical protein SORBIDRAFT_08g000890 [S... 97 4e-18 ref|XP_002441696.1| hypothetical protein SORBIDRAFT_08g000870 [S... 97 4e-18 ref|XP_010249456.1| PREDICTED: putative pentatricopeptide repeat... 96 1e-17 >ref|XP_010103616.1| hypothetical protein L484_023114 [Morus notabilis] gi|587908440|gb|EXB96393.1| hypothetical protein L484_023114 [Morus notabilis] Length = 777 Score = 134 bits (338), Expect = 2e-29 Identities = 64/93 (68%), Positives = 76/93 (81%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GKQLHGL+I+ D+ STSLMNCLMDMYF NGM DSA+KVF RIQNKD+ISWNT F+S+S+ Sbjct: 247 GKQLHGLIIKGDVGFSTSLMNCLMDMYFSNGMMDSAMKVFHRIQNKDIISWNTLFSSISE 306 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + ++A L HEF L +KPN ITFSILFRLC Sbjct: 307 DKDTTEIACLIHEFFLRGMKPNHITFSILFRLC 339 >ref|XP_007224913.1| hypothetical protein PRUPE_ppa021912mg, partial [Prunus persica] gi|462421849|gb|EMJ26112.1| hypothetical protein PRUPE_ppa021912mg, partial [Prunus persica] Length = 744 Score = 129 bits (324), Expect = 9e-28 Identities = 62/93 (66%), Positives = 73/93 (78%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GKQLHGL+IQS+ME STS+MN L DMY +NG KD+ALKVF+RIQ KDVISWNT F S+ Sbjct: 181 GKQLHGLIIQSEMEFSTSVMNALSDMYSRNGKKDAALKVFNRIQAKDVISWNTAFGVFSE 240 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 N R++A L HEF L +KPN +TFSILFR C Sbjct: 241 DKNTREIAKLVHEFMLANMKPNHVTFSILFRQC 273 >ref|XP_008382731.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] gi|657981432|ref|XP_008382732.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] gi|657981434|ref|XP_008382733.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Malus domestica] Length = 802 Score = 125 bits (313), Expect = 2e-26 Identities = 60/94 (63%), Positives = 75/94 (79%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GKQLHGL+IQS+++ STS+MN LMDMY +NG D AL+VF+RIQ KDVISWNT F + Sbjct: 271 GKQLHGLIIQSELKLSTSVMNALMDMYSRNGRIDLALQVFNRIQTKDVISWNTAFGVFFE 330 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLCA 2 NAR++A+L HEF L+ +KPN ITFSILFR C+ Sbjct: 331 GKNAREIANLVHEFMLENMKPNHITFSILFRQCS 364 >ref|XP_009346026.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Pyrus x bretschneideri] gi|694438071|ref|XP_009346027.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Pyrus x bretschneideri] gi|694438074|ref|XP_009346028.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Pyrus x bretschneideri] Length = 760 Score = 124 bits (311), Expect = 3e-26 Identities = 59/93 (63%), Positives = 73/93 (78%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GKQLHGL+IQS+++ STS+MN LMDMY +NG D AL VF+RIQ KDVISWNT F + Sbjct: 229 GKQLHGLIIQSELKLSTSVMNALMDMYSRNGRMDLALHVFNRIQTKDVISWNTAFGVFFE 288 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 NAR++A+L HEF L+ +KPN ITFS+LFR C Sbjct: 289 GKNAREIANLVHEFMLENMKPNHITFSVLFRQC 321 >ref|XP_008223913.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Prunus mume] Length = 780 Score = 124 bits (311), Expect = 3e-26 Identities = 60/93 (64%), Positives = 71/93 (76%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GKQLHGL+IQS+ME S S+MN L DMY +NG KD+ALKVF+RIQ KDVISWNT F S+ Sbjct: 249 GKQLHGLIIQSEMEFSISVMNALSDMYSRNGKKDAALKVFNRIQAKDVISWNTAFGVFSE 308 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 N ++A L HEF L +KPN +TFSILFR C Sbjct: 309 DHNTSEIAKLVHEFMLANMKPNHVTFSILFRQC 341 >ref|XP_002267326.2| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405714|ref|XP_010655892.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405716|ref|XP_010655893.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405718|ref|XP_010655894.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405720|ref|XP_010655895.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405722|ref|XP_010655896.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] gi|731405724|ref|XP_010655897.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Vitis vinifera] Length = 798 Score = 120 bits (301), Expect = 4e-25 Identities = 57/93 (61%), Positives = 73/93 (78%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+IQS++ ST++MN LMDMYFKNG ALKVFDR+Q+KD+ISWNT FA LSQ Sbjct: 268 GRQIHGLIIQSEVGFSTAVMNSLMDMYFKNGGGLYALKVFDRLQDKDIISWNTVFAGLSQ 327 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 +AR++ FH+ L +KPN +TFSILFR C Sbjct: 328 GDDAREIGRFFHKLMLTGLKPNCVTFSILFRFC 360 >emb|CBI28998.3| unnamed protein product [Vitis vinifera] Length = 732 Score = 120 bits (301), Expect = 4e-25 Identities = 57/93 (61%), Positives = 73/93 (78%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+IQS++ ST++MN LMDMYFKNG ALKVFDR+Q+KD+ISWNT FA LSQ Sbjct: 202 GRQIHGLIIQSEVGFSTAVMNSLMDMYFKNGGGLYALKVFDRLQDKDIISWNTVFAGLSQ 261 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 +AR++ FH+ L +KPN +TFSILFR C Sbjct: 262 GDDAREIGRFFHKLMLTGLKPNCVTFSILFRFC 294 >ref|XP_011041952.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897329|ref|XP_011041953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897331|ref|XP_011041954.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] gi|743897333|ref|XP_011041955.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Populus euphratica] Length = 805 Score = 115 bits (289), Expect = 1e-23 Identities = 52/93 (55%), Positives = 71/93 (76%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S +MN LMDMYFKNG +S L VF ++ ++DV+SWNT F S SQ Sbjct: 275 GRQIHGLIIRSELELSAPVMNALMDMYFKNGGMNSGLVVFKKMHDQDVVSWNTVFGSFSQ 334 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 H + + +A LFH F L +++PN ITFSILFR C Sbjct: 335 HEDPKDIASLFHSFLLTSMRPNHITFSILFREC 367 >ref|XP_002314200.2| hypothetical protein POPTR_0009s03250g, partial [Populus trichocarpa] gi|550330939|gb|EEE88155.2| hypothetical protein POPTR_0009s03250g, partial [Populus trichocarpa] Length = 758 Score = 114 bits (285), Expect = 3e-23 Identities = 51/93 (54%), Positives = 70/93 (75%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S +MN LMDMYFKNG S L VF ++ ++DV++WNT F S SQ Sbjct: 229 GRQIHGLIIRSELELSAPVMNALMDMYFKNGGMKSGLVVFKKMHDRDVVTWNTVFGSFSQ 288 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 H + + +A LFH F L +++PN ITFSILFR C Sbjct: 289 HEDPKDIASLFHSFLLTSMRPNHITFSILFREC 321 >ref|XP_010931320.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Elaeis guineensis] Length = 743 Score = 105 bits (262), Expect = 1e-20 Identities = 43/93 (46%), Positives = 68/93 (73%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+H ++IQ++ E++TS+MN L+DMYF+ GMKDS +KVF + + KD++SWNT + Q Sbjct: 215 GRQIHCMIIQNEFENNTSVMNSLIDMYFRTGMKDSGVKVFGKTKEKDIVSWNTVISGFVQ 274 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + +++ DLF L +KPN +T S++FRLC Sbjct: 275 EEDEKQVVDLFSNMLLSGLKPNQVTLSVIFRLC 307 >ref|XP_008792261.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Phoenix dactylifera] Length = 383 Score = 104 bits (259), Expect = 3e-20 Identities = 43/93 (46%), Positives = 67/93 (72%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+H L+IQ++ E++TS+MN L+DMYF+ GMKDS +KVF + + KD++SWNT + Sbjct: 178 GRQIHCLIIQNEFENNTSVMNSLIDMYFRTGMKDSGVKVFGKTREKDIVSWNTVISGFVH 237 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + +++ DLF L +KPN +T S++FRLC Sbjct: 238 EEDEKQVVDLFSNMLLSGLKPNQVTLSVIFRLC 270 >gb|KDO69875.1| hypothetical protein CISIN_1g0362902mg, partial [Citrus sinensis] Length = 761 Score = 103 bits (258), Expect = 4e-20 Identities = 48/93 (51%), Positives = 67/93 (72%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S S++N L+DMY K+ D A KVF+R+ +KDVISWNT F S+ Sbjct: 265 GRQIHGLIIRSEVECSISIVNALIDMYIKSSGMDYAFKVFERMADKDVISWNTLFGGFSE 324 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + N + A LFH+F L +PN +TFSIL R C Sbjct: 325 NKNPGQTASLFHKFILSGSRPNHVTFSILLRQC 357 >ref|XP_006484505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X2 [Citrus sinensis] Length = 752 Score = 103 bits (258), Expect = 4e-20 Identities = 48/93 (51%), Positives = 67/93 (72%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S S++N L+DMY K+ D A KVF+R+ +KDVISWNT F S+ Sbjct: 265 GRQIHGLIIRSEVECSISIVNALIDMYIKSSGMDYAFKVFERMADKDVISWNTLFGGFSE 324 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + N + A LFH+F L +PN +TFSIL R C Sbjct: 325 NKNPGQTASLFHKFILSGSRPNHVTFSILLRQC 357 >ref|XP_006484504.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like isoform X1 [Citrus sinensis] Length = 798 Score = 103 bits (258), Expect = 4e-20 Identities = 48/93 (51%), Positives = 67/93 (72%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S S++N L+DMY K+ D A KVF+R+ +KDVISWNT F S+ Sbjct: 265 GRQIHGLIIRSEVECSISIVNALIDMYIKSSGMDYAFKVFERMADKDVISWNTLFGGFSE 324 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + N + A LFH+F L +PN +TFSIL R C Sbjct: 325 NKNPGQTASLFHKFILSGSRPNHVTFSILLRQC 357 >ref|XP_006437631.1| hypothetical protein CICLE_v10030859mg [Citrus clementina] gi|557539827|gb|ESR50871.1| hypothetical protein CICLE_v10030859mg [Citrus clementina] Length = 694 Score = 103 bits (258), Expect = 4e-20 Identities = 48/93 (51%), Positives = 67/93 (72%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+I+S++E S S++N L+DMY K+ D A KVF+R+ +KDVISWNT F S+ Sbjct: 161 GRQIHGLIIRSEVECSISIVNALIDMYIKSSGMDYAFKVFERMADKDVISWNTLFGGFSE 220 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + N + A LFH+F L +PN +TFSIL R C Sbjct: 221 NKNPGQTASLFHKFILSGSRPNHVTFSILLRQC 253 >ref|XP_010031940.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Eucalyptus grandis] gi|702476006|ref|XP_010031941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Eucalyptus grandis] Length = 805 Score = 100 bits (248), Expect = 6e-19 Identities = 47/93 (50%), Positives = 65/93 (69%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GK LHGL++ S+M+ S +MN L+DMY KN + A +VFDR+ KDVISWNT F + + Sbjct: 274 GKLLHGLIMCSNMQFSIPVMNSLIDMYHKNCQEKYAFEVFDRMLKKDVISWNTIFGAFHE 333 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + K+A LF +F L +KPN++TFS+LFR C Sbjct: 334 EQDVTKVAGLFRKFMLAGLKPNEVTFSVLFRQC 366 >gb|KCW51340.1| hypothetical protein EUGRSUZ_J00891 [Eucalyptus grandis] Length = 709 Score = 100 bits (248), Expect = 6e-19 Identities = 47/93 (50%), Positives = 65/93 (69%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 GK LHGL++ S+M+ S +MN L+DMY KN + A +VFDR+ KDVISWNT F + + Sbjct: 178 GKLLHGLIMCSNMQFSIPVMNSLIDMYHKNCQEKYAFEVFDRMLKKDVISWNTIFGAFHE 237 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 + K+A LF +F L +KPN++TFS+LFR C Sbjct: 238 EQDVTKVAGLFRKFMLAGLKPNEVTFSVLFRQC 270 >ref|XP_002441698.1| hypothetical protein SORBIDRAFT_08g000890 [Sorghum bicolor] gi|241942391|gb|EES15536.1| hypothetical protein SORBIDRAFT_08g000890 [Sorghum bicolor] Length = 402 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/92 (48%), Positives = 63/92 (68%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGLVI S+ E +TS+MN LMDMYFK G K++A+ +F +IQ KD +SWNT + L+ Sbjct: 54 GRQVHGLVIHSEFESNTSVMNTLMDMYFKAGQKEAAVGIFGKIQWKDTVSWNTMISGLAH 113 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRL 8 + R AD F + KPN +TFS++ RL Sbjct: 114 DEDERAAADCFFDMSRFGCKPNQVTFSVMLRL 145 >ref|XP_002441696.1| hypothetical protein SORBIDRAFT_08g000870 [Sorghum bicolor] gi|241942389|gb|EES15534.1| hypothetical protein SORBIDRAFT_08g000870 [Sorghum bicolor] Length = 810 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/92 (48%), Positives = 63/92 (68%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGLVI S+ E +TS+MN LMDMYFK G K++A+ +F +IQ KD +SWNT + L+ Sbjct: 278 GRQVHGLVIHSEFESNTSVMNTLMDMYFKAGQKEAAVVIFGKIQWKDTVSWNTMISGLAH 337 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRL 8 + R AD F + KPN +TFS++ RL Sbjct: 338 DEDERAAADCFFDMSRYGCKPNQVTFSVMLRL 369 >ref|XP_010249456.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g25970 [Nelumbo nucifera] Length = 802 Score = 95.5 bits (236), Expect = 1e-17 Identities = 45/93 (48%), Positives = 65/93 (69%) Frame = -1 Query: 283 GKQLHGLVIQSDMEHSTSLMNCLMDMYFKNGMKDSALKVFDRIQNKDVISWNTTFASLSQ 104 G+Q+HGL+++S +E T +N LM MYFK G DSALK+F++++ +D+ISWNT F+ S+ Sbjct: 273 GRQIHGLMVRSKLE-CTPGINSLMYMYFKTGEHDSALKLFNKMEERDIISWNTVFSGFSE 331 Query: 103 HVNARKLADLFHEFRLDTVKPNDITFSILFRLC 5 N ++ +F L V PN +TFSILFRLC Sbjct: 332 DENVGEVVGMFSRMLLTGVMPNHVTFSILFRLC 364