BLASTX nr result
ID: Ziziphus21_contig00020132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020132 (303 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA03972.1| hypothetical protein SOVF_204050 isoform B [Spina... 56 9e-06 gb|KNA03971.1| hypothetical protein SOVF_204050 isoform A [Spina... 56 9e-06 >gb|KNA03972.1| hypothetical protein SOVF_204050 isoform B [Spinacia oleracea] Length = 658 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/69 (49%), Positives = 42/69 (60%) Frame = -3 Query: 208 MATLVGTPWMRIRVFPEVAYPIFLPSSLCCRHRKFSDFVRTTTTRSFSVLASSITDHSKK 29 MAT+VGTPW+RI+V P+ PIF S L HR F R R+FS+ ASS + KK Sbjct: 1 MATMVGTPWIRIKVIPDFHSPIFRQSPLSL-HRTFRRHFR----RNFSIYASSDSPFPKK 55 Query: 28 VEEPVRVRF 2 + VRVRF Sbjct: 56 NDGEVRVRF 64 >gb|KNA03971.1| hypothetical protein SOVF_204050 isoform A [Spinacia oleracea] Length = 577 Score = 56.2 bits (134), Expect = 9e-06 Identities = 34/69 (49%), Positives = 42/69 (60%) Frame = -3 Query: 208 MATLVGTPWMRIRVFPEVAYPIFLPSSLCCRHRKFSDFVRTTTTRSFSVLASSITDHSKK 29 MAT+VGTPW+RI+V P+ PIF S L HR F R R+FS+ ASS + KK Sbjct: 1 MATMVGTPWIRIKVIPDFHSPIFRQSPLSL-HRTFRRHFR----RNFSIYASSDSPFPKK 55 Query: 28 VEEPVRVRF 2 + VRVRF Sbjct: 56 NDGEVRVRF 64