BLASTX nr result
ID: Ziziphus21_contig00020104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020104 (386 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008240365.1| PREDICTED: rhodanese-like domain-containing ... 65 3e-08 ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase sup... 64 4e-08 ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase sup... 64 4e-08 ref|XP_011086965.1| PREDICTED: rhodanese-like domain-containing ... 64 6e-08 gb|KHG14248.1| hypothetical protein F383_17325 [Gossypium arboreum] 63 1e-07 ref|XP_006416661.1| hypothetical protein EUTSA_v10007680mg [Eutr... 62 1e-07 ref|XP_012469270.1| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 ref|XP_012469262.1| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 ref|XP_012469238.1| PREDICTED: rhodanese-like domain-containing ... 62 2e-07 gb|KJB08179.1| hypothetical protein B456_001G0706002, partial [G... 62 2e-07 ref|XP_009594000.1| PREDICTED: rhodanese-like domain-containing ... 60 5e-07 ref|XP_011047775.1| PREDICTED: rhodanese-like domain-containing ... 59 1e-06 ref|XP_010535280.1| PREDICTED: rhodanese-like domain-containing ... 59 1e-06 ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Popu... 59 1e-06 gb|KRH41905.1| hypothetical protein GLYMA_08G057600 [Glycine max] 59 2e-06 gb|KRH41903.1| hypothetical protein GLYMA_08G057600 [Glycine max] 59 2e-06 gb|KRH41901.1| hypothetical protein GLYMA_08G057600 [Glycine max] 59 2e-06 ref|XP_013641742.1| PREDICTED: rhodanese-like domain-containing ... 58 3e-06 ref|XP_009149238.1| PREDICTED: rhodanese-like domain-containing ... 58 3e-06 emb|CDY26210.1| BnaA06g12070D [Brassica napus] 58 3e-06 >ref|XP_008240365.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Prunus mume] Length = 460 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/65 (49%), Positives = 43/65 (66%) Frame = -1 Query: 197 AKSGKNQHGSGIGIGRRIPVQCCKCRDVEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKG 18 ++ K + G +G+ ++ Q C E+ + VVVNFY FVFIKD AEVAKHLSFL+G Sbjct: 73 SERSKWKGGRSVGVALQVQQQQCTYESREDKEWVVVNFYHFVFIKDAEAEVAKHLSFLEG 132 Query: 17 FDIKG 3 DI+G Sbjct: 133 RDIRG 137 >ref|XP_007037152.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] gi|508774397|gb|EOY21653.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 2 [Theobroma cacao] Length = 431 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 8/88 (9%) Frame = -1 Query: 242 FSHGHPKPFLFFTNKAKSGKNQHGSGIGIGRRIPVQCC--------KCRDVEEDDLVVVN 87 F HG P+ + + + K + R I + CC K E ++ VVVN Sbjct: 34 FHHGFPRKVVGIKSNNNTRK--------VHRAISISCCASASNSNDKVCQAEIENFVVVN 85 Query: 86 FYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 FYRFVFIKDP EVAKHL+FLKG +I G Sbjct: 86 FYRFVFIKDPQHEVAKHLTFLKGLNIHG 113 >ref|XP_007037151.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] gi|508774396|gb|EOY21652.1| Rhodanese/Cell cycle control phosphatase superfamily protein isoform 1 [Theobroma cacao] Length = 498 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/88 (42%), Positives = 47/88 (53%), Gaps = 8/88 (9%) Frame = -1 Query: 242 FSHGHPKPFLFFTNKAKSGKNQHGSGIGIGRRIPVQCC--------KCRDVEEDDLVVVN 87 F HG P+ + + + K + R I + CC K E ++ VVVN Sbjct: 34 FHHGFPRKVVGIKSNNNTRK--------VHRAISISCCASASNSNDKVCQAEIENFVVVN 85 Query: 86 FYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 FYRFVFIKDP EVAKHL+FLKG +I G Sbjct: 86 FYRFVFIKDPQHEVAKHLTFLKGLNIHG 113 >ref|XP_011086965.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Sesamum indicum] Length = 444 Score = 63.5 bits (153), Expect = 6e-08 Identities = 37/93 (39%), Positives = 53/93 (56%) Frame = -1 Query: 281 SYPFQPRFCSANFFSHGHPKPFLFFTNKAKSGKNQHGSGIGIGRRIPVQCCKCRDVEEDD 102 S ++ FCS + FS + + F A S N G + V+ ++ E+D+ Sbjct: 45 SLQYKHNFCSGSRFSWKYGESFNLL---AFSSSN--------GNWVEVEAGARKEYEDDE 93 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 +VVNFYRFVFI+DP EV+KHLSF++G DI G Sbjct: 94 FIVVNFYRFVFIQDPEEEVSKHLSFMQGRDIHG 126 >gb|KHG14248.1| hypothetical protein F383_17325 [Gossypium arboreum] Length = 409 Score = 62.8 bits (151), Expect = 1e-07 Identities = 41/93 (44%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = -1 Query: 254 SANFFSHGHPKPFLFFT-NKAKSGKNQHGSGIGIGRRIPVQCCKCRDV--------EEDD 102 S + SH PKP + N K++ I R K +V E DD Sbjct: 14 SLSLGSHSLPKPAYYCCFNYGFPVKSRKAPFCAISIRCCASASKSYNVNKILQAEPEIDD 73 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 VVVNFYRFVFIKDP E+AKHL+FLKG DI G Sbjct: 74 FVVVNFYRFVFIKDPQHEIAKHLTFLKGLDIHG 106 >ref|XP_006416661.1| hypothetical protein EUTSA_v10007680mg [Eutrema salsugineum] gi|557094432|gb|ESQ35014.1| hypothetical protein EUTSA_v10007680mg [Eutrema salsugineum] Length = 434 Score = 62.4 bits (150), Expect = 1e-07 Identities = 42/116 (36%), Positives = 56/116 (48%), Gaps = 12/116 (10%) Frame = -1 Query: 314 SSILAPLDINRSYPFQPRFCSANFFSHGHPKPFLFFTNKAKSGKNQHGSGIGIGRRIPVQ 135 S + A L ++ + P P S N G P F + + +S G R Sbjct: 4 SPVSAILSVSLTLPLLP-LASTNTRFSGDPIRFRQYVSHNRSLSRPGGLVFEKPGRRWTF 62 Query: 134 CCKCRDV------------EEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 CCKCR E +D +V+NFYRFV I+DP AE+AKHLSFLK +I+G Sbjct: 63 CCKCRHRQGNGYAKSEALNEGEDFIVLNFYRFVSIEDPAAEIAKHLSFLKDLNIRG 118 >ref|XP_012469270.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X3 [Gossypium raimondii] Length = 334 Score = 61.6 bits (148), Expect = 2e-07 Identities = 40/93 (43%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = -1 Query: 254 SANFFSHGHPKPFLFFT-NKAKSGKNQHGSGIGIGRRIPVQCCKCRDV--------EEDD 102 S + SH PKP + N K++ I R K +V E DD Sbjct: 14 SLSLGSHSLPKPAYYCCFNYGFPVKSRKAPFCAISIRCCASASKSYNVNKILQAEPEIDD 73 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 VVVNFYRFVFI+DP E+AKHL+FLKG DI G Sbjct: 74 FVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHG 106 >ref|XP_012469262.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Gossypium raimondii] Length = 341 Score = 61.6 bits (148), Expect = 2e-07 Identities = 40/93 (43%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = -1 Query: 254 SANFFSHGHPKPFLFFT-NKAKSGKNQHGSGIGIGRRIPVQCCKCRDV--------EEDD 102 S + SH PKP + N K++ I R K +V E DD Sbjct: 14 SLSLGSHSLPKPAYYCCFNYGFPVKSRKAPFCAISIRCCASASKSYNVNKILQAEPEIDD 73 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 VVVNFYRFVFI+DP E+AKHL+FLKG DI G Sbjct: 74 FVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHG 106 >ref|XP_012469238.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] gi|823122066|ref|XP_012469245.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] gi|823122068|ref|XP_012469254.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Gossypium raimondii] Length = 426 Score = 61.6 bits (148), Expect = 2e-07 Identities = 40/93 (43%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = -1 Query: 254 SANFFSHGHPKPFLFFT-NKAKSGKNQHGSGIGIGRRIPVQCCKCRDV--------EEDD 102 S + SH PKP + N K++ I R K +V E DD Sbjct: 14 SLSLGSHSLPKPAYYCCFNYGFPVKSRKAPFCAISIRCCASASKSYNVNKILQAEPEIDD 73 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 VVVNFYRFVFI+DP E+AKHL+FLKG DI G Sbjct: 74 FVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHG 106 >gb|KJB08179.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740681|gb|KJB08180.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740682|gb|KJB08181.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] gi|763740683|gb|KJB08182.1| hypothetical protein B456_001G0706002, partial [Gossypium raimondii] Length = 168 Score = 61.6 bits (148), Expect = 2e-07 Identities = 40/93 (43%), Positives = 48/93 (51%), Gaps = 9/93 (9%) Frame = -1 Query: 254 SANFFSHGHPKPFLFFT-NKAKSGKNQHGSGIGIGRRIPVQCCKCRDV--------EEDD 102 S + SH PKP + N K++ I R K +V E DD Sbjct: 14 SLSLGSHSLPKPAYYCCFNYGFPVKSRKAPFCAISIRCCASASKSYNVNKILQAEPEIDD 73 Query: 101 LVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 VVVNFYRFVFI+DP E+AKHL+FLKG DI G Sbjct: 74 FVVVNFYRFVFIRDPQHEIAKHLTFLKGLDIHG 106 >ref|XP_009594000.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X2 [Nicotiana tomentosiformis] Length = 437 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -1 Query: 119 DVEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 D++E++ +VVNFYRFVFIKDP EV KHLSF++G D+ G Sbjct: 78 DIDEEEFIVVNFYRFVFIKDPEEEVTKHLSFMEGRDVHG 116 >ref|XP_011047775.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic isoform X1 [Populus euphratica] Length = 458 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 107 DDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 +D +VVNFYRFVFI DP EVAKHLSFLKG DI G Sbjct: 109 NDFIVVNFYRFVFINDPREEVAKHLSFLKGLDIHG 143 >ref|XP_010535280.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Tarenaya hassleriana] Length = 430 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/56 (51%), Positives = 35/56 (62%), Gaps = 12/56 (21%) Frame = -1 Query: 134 CCKCRD------------VEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 CCKCR +E +D +VVNFY FV I+DP+AEV KHL+FLK DI G Sbjct: 54 CCKCRRGGENGYTREEPLIEGEDYIVVNFYSFVLIRDPVAEVEKHLAFLKELDIHG 109 >ref|XP_006374262.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] gi|550322019|gb|ERP52059.1| hypothetical protein POPTR_0015s05490g [Populus trichocarpa] Length = 460 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -1 Query: 107 DDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 +D +VVNFYRFVFI DP EVAKHLSFLKG DI G Sbjct: 88 NDFIVVNFYRFVFINDPHEEVAKHLSFLKGLDIHG 122 >gb|KRH41905.1| hypothetical protein GLYMA_08G057600 [Glycine max] Length = 251 Score = 58.5 bits (140), Expect = 2e-06 Identities = 46/131 (35%), Positives = 62/131 (47%), Gaps = 3/131 (2%) Frame = -1 Query: 386 EEEEKSSVRDDEMRVFGGVSCGAFSSILAPLDINRSYPFQPRFCSANF-FSHGHPKPFLF 210 +E + + V+ +RV+ G +C S RSY F FC+ +F KP Sbjct: 20 QERKDAVVQRGLLRVWVGCTCTCTRS--------RSYSFTTSFCNTSFVLQFQFQKPLFK 71 Query: 209 FTNKAKSGKNQHGSGIGIGRRIPVQCCKCRDVEEDDLVVVNFYRFVFIKDPLAEVAKHLS 30 F+N + H + + +D D VVVNFY FVFI+DP AEVAKH S Sbjct: 72 FSNFSSLALT-HCKLVPSALPLTQPSSSRKDF---DFVVVNFYHFVFIQDPQAEVAKHRS 127 Query: 29 F--LKGFDIKG 3 F L+G DI G Sbjct: 128 FLELEGLDING 138 >gb|KRH41903.1| hypothetical protein GLYMA_08G057600 [Glycine max] Length = 261 Score = 58.5 bits (140), Expect = 2e-06 Identities = 46/131 (35%), Positives = 62/131 (47%), Gaps = 3/131 (2%) Frame = -1 Query: 386 EEEEKSSVRDDEMRVFGGVSCGAFSSILAPLDINRSYPFQPRFCSANF-FSHGHPKPFLF 210 +E + + V+ +RV+ G +C S RSY F FC+ +F KP Sbjct: 20 QERKDAVVQRGLLRVWVGCTCTCTRS--------RSYSFTTSFCNTSFVLQFQFQKPLFK 71 Query: 209 FTNKAKSGKNQHGSGIGIGRRIPVQCCKCRDVEEDDLVVVNFYRFVFIKDPLAEVAKHLS 30 F+N + H + + +D D VVVNFY FVFI+DP AEVAKH S Sbjct: 72 FSNFSSLALT-HCKLVPSALPLTQPSSSRKDF---DFVVVNFYHFVFIQDPQAEVAKHRS 127 Query: 29 F--LKGFDIKG 3 F L+G DI G Sbjct: 128 FLELEGLDING 138 >gb|KRH41901.1| hypothetical protein GLYMA_08G057600 [Glycine max] Length = 287 Score = 58.5 bits (140), Expect = 2e-06 Identities = 46/131 (35%), Positives = 62/131 (47%), Gaps = 3/131 (2%) Frame = -1 Query: 386 EEEEKSSVRDDEMRVFGGVSCGAFSSILAPLDINRSYPFQPRFCSANF-FSHGHPKPFLF 210 +E + + V+ +RV+ G +C S RSY F FC+ +F KP Sbjct: 20 QERKDAVVQRGLLRVWVGCTCTCTRS--------RSYSFTTSFCNTSFVLQFQFQKPLFK 71 Query: 209 FTNKAKSGKNQHGSGIGIGRRIPVQCCKCRDVEEDDLVVVNFYRFVFIKDPLAEVAKHLS 30 F+N + H + + +D D VVVNFY FVFI+DP AEVAKH S Sbjct: 72 FSNFSSLALT-HCKLVPSALPLTQPSSSRKDF---DFVVVNFYHFVFIQDPQAEVAKHRS 127 Query: 29 F--LKGFDIKG 3 F L+G DI G Sbjct: 128 FLELEGLDING 138 >ref|XP_013641742.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Brassica napus] Length = 429 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 9/52 (17%) Frame = -1 Query: 131 CKCR---------DVEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 C+CR D E +D +VVNFYRFV I+DP AE+AKHLSFL+ +I+G Sbjct: 61 CQCRNRGRNYSKFDDEGEDFIVVNFYRFVSIQDPAAEIAKHLSFLQDLNIRG 112 >ref|XP_009149238.1| PREDICTED: rhodanese-like domain-containing protein 8, chloroplastic [Brassica rapa] Length = 428 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 9/52 (17%) Frame = -1 Query: 131 CKCR---------DVEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 C+CR D E +D +VVNFYRFV I+DP AE+AKHLSFL+ +I+G Sbjct: 60 CQCRNRGRNYSKFDDEGEDFIVVNFYRFVSIQDPAAEIAKHLSFLQDLNIRG 111 >emb|CDY26210.1| BnaA06g12070D [Brassica napus] Length = 438 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 9/52 (17%) Frame = -1 Query: 131 CKCR---------DVEEDDLVVVNFYRFVFIKDPLAEVAKHLSFLKGFDIKG 3 C+CR D E +D +VVNFYRFV I+DP AE+AKHLSFL+ +I+G Sbjct: 71 CQCRNRGRNYSKFDDEGEDFIVVNFYRFVSIQDPAAEIAKHLSFLQDLNIRG 122