BLASTX nr result
ID: Ziziphus21_contig00020073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00020073 (285 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096724.1| hypothetical protein L484_025842 [Morus nota... 82 2e-13 >ref|XP_010096724.1| hypothetical protein L484_025842 [Morus notabilis] gi|587876489|gb|EXB65576.1| hypothetical protein L484_025842 [Morus notabilis] Length = 1048 Score = 82.0 bits (201), Expect = 2e-13 Identities = 43/96 (44%), Positives = 64/96 (66%), Gaps = 4/96 (4%) Frame = +2 Query: 8 HRHNGEPLIKKVNLGISWSWKQEKRSIMLAANLESSNSPHVNPIPVTCATQD----SGLV 175 ++H EPL KKVNL I+WSWK+ ++ A+N S S HV +P A Q+ + LV Sbjct: 164 YKHCREPLAKKVNLEIAWSWKRREQHNARASNQVFSYSSHVTEVPDNSARQNPNFQTSLV 223 Query: 176 YKDRGIMCVKDNTPSSVLNRENNIVRETNSQSKPLT 283 ++DRG+M K+N P+SVL +E+++++ETNS S LT Sbjct: 224 HQDRGVMWAKENIPTSVLIQESDLLQETNSDSYLLT 259