BLASTX nr result
ID: Ziziphus21_contig00019854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019854 (392 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095969.1| Cytochrome c oxidase assembly protein COX11 ... 58 2e-06 >ref|XP_010095969.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] gi|587873477|gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis] Length = 282 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -2 Query: 169 SRCIPNDFRRSNYNFIRGNTGYNSSFGNNMWRLELICEFNTSSFGKNCQL 20 SRC+P+D S+Y+F RGN GY G N+WR ELI EF+T SF K Q+ Sbjct: 24 SRCLPHDLVSSSYSFTRGNNGYWRPVGYNIWRTELIHEFSTGSFDKYRQV 73