BLASTX nr result
ID: Ziziphus21_contig00019727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019727 (418 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010106647.1| Zinc finger Ran-binding domain-containing pr... 59 1e-06 >ref|XP_010106647.1| Zinc finger Ran-binding domain-containing protein 3 [Morus notabilis] gi|587923691|gb|EXC11026.1| Zinc finger Ran-binding domain-containing protein 3 [Morus notabilis] Length = 972 Score = 59.3 bits (142), Expect = 1e-06 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 1/125 (0%) Frame = -1 Query: 406 EDSMLENTQCVELSAQPQSFENSCLLKDTESSGACHE-LEKTVHRSGEDSSRDDCSTQTE 230 ++ +LE + E SAQP F+ S LLKDTE S E +++ R + ++ + S +T+ Sbjct: 586 KNKILEIVETGEPSAQPLEFQESSLLKDTEPSEVNDEFVDEVTPRYEKKTNVEGSSAKTD 645 Query: 229 NCLNEELVLSGAEADKDLVSEGNFVGDSSEIKFREAGGVNSPKSDKGCEDDNELEKGNLF 50 N L + +V G +ADK V E + SE K +AG E ++L++GN+F Sbjct: 646 NYLIKAMVTCGVDADKGSVLEAKLEENLSERKTSKAGK----------ESLSKLDEGNIF 695 Query: 49 YPQTE 35 PQ E Sbjct: 696 SPQME 700