BLASTX nr result
ID: Ziziphus21_contig00019646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019646 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206733.1| hypothetical protein PRUPE_ppa024822mg [Prun... 57 7e-06 >ref|XP_007206733.1| hypothetical protein PRUPE_ppa024822mg [Prunus persica] gi|462402375|gb|EMJ07932.1| hypothetical protein PRUPE_ppa024822mg [Prunus persica] Length = 1076 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +3 Query: 192 LSVSGALNHAKQKKMEDMDSRQWLGEFKDAICCVEDLVGEIKSQAFRCKVE 344 LSV+ L+ A++K++ + D +QWL E K+A+ EDL+ EIK++A RCKVE Sbjct: 47 LSVNAVLDDAEEKQISNQDVKQWLEELKEAVYDAEDLLNEIKTEALRCKVE 97