BLASTX nr result
ID: Ziziphus21_contig00019522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019522 (940 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapan... 81 1e-12 ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapan... 81 1e-12 ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassai... 81 1e-12 ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassai... 81 1e-12 ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopan... 80 2e-12 ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopan... 80 2e-12 gb|AFK38361.1| unknown [Medicago truncatula] 64 9e-11 gb|AKJ77552.1| ribosomal protein S12 (chloroplast) [Dioscorea ni... 74 2e-10 gb|AKJ77464.1| ribosomal protein S12 (chloroplast) [Carthamus ti... 73 3e-10 gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinque... 73 3e-10 ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberi... 73 4e-10 ref|YP_009144538.1| ribosomal protein S12 (chloroplast) [Rosmari... 71 1e-09 gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sin... 71 1e-09 gb|KRH17326.1| hypothetical protein GLYMA_14G213500 [Glycine max] 70 2e-09 ref|YP_009020767.1| ribosomal protein S12 (chloroplast) [Praxeli... 70 3e-09 ref|YP_009179975.1| ribosomal protein S12 (chloroplast) [Bletill... 69 4e-09 ref|YP_009179709.1| ribosomal protein S12 (chloroplast) [Isatis ... 69 4e-09 gb|AKJ77627.1| ribosomal protein S12 (chloroplast) [Fagopyrum cy... 69 5e-09 ref|YP_009139492.1| ribosomal protein S12 (chloroplast) [Dunalia... 69 5e-09 ref|YP_009139447.1| ribosomal protein S12 (chloroplast) [Dunalia... 69 5e-09 >ref|YP_008815054.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599431|gb|AGG39190.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 161 Score = 80.9 bits (198), Expect = 1e-12 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPV 795 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT + Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSI 57 >ref|YP_008815009.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] gi|458599418|gb|AGG39177.1| ribosomal protein S12 (chloroplast) [Metapanax delavayi] Length = 165 Score = 80.9 bits (198), Expect = 1e-12 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPV 795 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT + Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSI 57 >ref|YP_008814967.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603148|ref|YP_008815141.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940339|ref|YP_008814880.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599150|gb|AGG39016.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599252|gb|AGG39103.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599584|gb|AGG39277.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 149 Score = 80.9 bits (198), Expect = 1e-12 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPV 795 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT + Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSI 57 >ref|YP_008814922.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|558603135|ref|YP_008815096.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] gi|563940326|ref|YP_008814835.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599137|gb|AGG39003.1| ribosomal protein S12 (chloroplast) [Aralia undulata] gi|458599239|gb|AGG39090.1| ribosomal protein S12 (chloroplast) [Brassaiopsis hainla] gi|458599571|gb|AGG39264.1| ribosomal protein S12 (chloroplast) [Schefflera delavayi] Length = 150 Score = 80.9 bits (198), Expect = 1e-12 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPV 795 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT + Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKTFSSI 57 >ref|YP_008815228.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599672|gb|AGG39364.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 142 Score = 80.1 bits (196), Expect = 2e-12 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKT 807 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKT 53 >ref|YP_008815183.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] gi|458599659|gb|AGG39351.1| ribosomal protein S12 (chloroplast) [Kalopanax septemlobus] Length = 143 Score = 80.1 bits (196), Expect = 2e-12 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKT 807 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM KRKKT Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIMSWDKRKKT 53 >gb|AFK38361.1| unknown [Medicago truncatula] Length = 82 Score = 63.9 bits (154), Expect(2) = 9e-11 Identities = 34/61 (55%), Positives = 38/61 (62%) Frame = -1 Query: 613 FPIGRKWYPLSREIRFKRRKGYALILDSCKNGLTGSATQLIFIIKYRYCIGGFRCERPIT 434 FP+ YPLS + +K L C NGL GS TQLIFI+KYRYCI F CERPIT Sbjct: 5 FPLVTNSYPLSGKNPILNKK---LCPKFCNNGLRGSTTQLIFILKYRYCIARFCCERPIT 61 Query: 433 R 431 R Sbjct: 62 R 62 Score = 31.2 bits (69), Expect(2) = 9e-11 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 425 MGRAKECELYKLTITFIK 372 MGRA +CELYK TIT I+ Sbjct: 65 MGRAHKCELYKFTITLIE 82 >gb|AKJ77552.1| ribosomal protein S12 (chloroplast) [Dioscorea nipponica] gi|827346399|gb|AKJ77596.1| ribosomal protein S12 (chloroplast) [Dioscorea nipponica] Length = 141 Score = 73.6 bits (179), Expect = 2e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIM 831 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM Sbjct: 10 NTRQKIRNVTKSPALRGCPQRRGTCTRVYVRLVQIM 45 >gb|AKJ77464.1| ribosomal protein S12 (chloroplast) [Carthamus tinctorius] Length = 138 Score = 73.2 bits (178), Expect = 3e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIM 831 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQIM Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQIM 45 >gb|ABX26257.1| ribosomal protein S12-like protein [Panax quinquefolius] Length = 65 Score = 73.2 bits (178), Expect = 3e-10 Identities = 35/48 (72%), Positives = 38/48 (79%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPV 795 NTRQ ++NV KSPALRGCPQRRGTCTR YV LVQIM KRKKT + Sbjct: 10 NTRQPIRNVPKSPALRGCPQRRGTCTRGYVGLVQIMSWDKRKKTFSSI 57 >ref|YP_008592664.1| ribosomal protein S12 (chloroplast) [Berberis bealei] gi|536462705|gb|AGU37070.1| ribosomal protein S12 (chloroplast) [Berberis bealei] Length = 46 Score = 72.8 bits (177), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIM 831 NTRQ +KNVTKSPALRGCPQRRGTCTRVYVRLVQI+ Sbjct: 10 NTRQPIKNVTKSPALRGCPQRRGTCTRVYVRLVQII 45 >ref|YP_009144538.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|836643444|ref|YP_009144494.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|827345164|gb|AKJ76748.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] gi|827345204|gb|AKJ76788.1| ribosomal protein S12 (chloroplast) [Rosmarinus officinalis] Length = 128 Score = 70.9 bits (172), Expect = 1e-09 Identities = 34/52 (65%), Positives = 39/52 (75%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKKTIDPVLAIR 783 NTRQ V+NVTKSPALRGCPQRRGTCTRVYVRLV ++ K + V +R Sbjct: 10 NTRQPVRNVTKSPALRGCPQRRGTCTRVYVRLVYMITPKKPNSALRKVARVR 61 >gb|AGZ19166.1| ribosomal protein S12 (chloroplast) [Camellia sinensis] Length = 60 Score = 70.9 bits (172), Expect = 1e-09 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIMC*AKRKK 810 NTRQ ++NVTKSPAL GCPQRRGTCTRVYVRLVQIM K K+ Sbjct: 10 NTRQPIRNVTKSPALGGCPQRRGTCTRVYVRLVQIMGWDKTKE 52 >gb|KRH17326.1| hypothetical protein GLYMA_14G213500 [Glycine max] Length = 46 Score = 70.1 bits (170), Expect = 2e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIM 831 NTRQ ++NVTKSPALRGCPQR+GTCTRVYVRLVQI+ Sbjct: 10 NTRQPIRNVTKSPALRGCPQRQGTCTRVYVRLVQII 45 >ref|YP_009020767.1| ribosomal protein S12 (chloroplast) [Praxelis clematidea] gi|594543346|gb|AHM02427.1| ribosomal protein S12 (chloroplast) [Praxelis clematidea] Length = 126 Score = 69.7 bits (169), Expect = 3e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQ 837 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQ Sbjct: 92 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQ 125 >ref|YP_009179975.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|953244808|ref|YP_009179932.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|943496681|gb|ALL53022.1| ribosomal protein S12 (chloroplast) [Bletilla striata] gi|943496716|gb|ALL53057.1| ribosomal protein S12 (chloroplast) [Bletilla striata] Length = 127 Score = 69.3 bits (168), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQI 834 N RQ ++NVTKSPALRGCPQRRGTCTRVYVRLVQI Sbjct: 10 NARQPIRNVTKSPALRGCPQRRGTCTRVYVRLVQI 44 >ref|YP_009179709.1| ribosomal protein S12 (chloroplast) [Isatis tinctoria] gi|953244589|ref|YP_009179754.1| ribosomal protein S12 (chloroplast) [Isatis tinctoria] gi|943496354|gb|ALL45417.1| ribosomal protein S12 (chloroplast) [Isatis tinctoria] gi|943496393|gb|ALL45456.1| ribosomal protein S12 (chloroplast) [Isatis tinctoria] Length = 127 Score = 69.3 bits (168), Expect = 4e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQI 834 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLV I Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVMI 44 >gb|AKJ77627.1| ribosomal protein S12 (chloroplast) [Fagopyrum cymosum] gi|827346480|gb|AKJ77672.1| ribosomal protein S12 (chloroplast) [Fagopyrum cymosum] Length = 118 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQIM 831 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLV M Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVHSM 45 >ref|YP_009139492.1| ribosomal protein S12 (chloroplast) [Dunalia solanacea] gi|817597913|gb|AKF78473.1| ribosomal protein S12 (chloroplast) [Dunalia solanacea] Length = 128 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQI 834 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLV I Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVTI 44 >ref|YP_009139447.1| ribosomal protein S12 (chloroplast) [Dunalia solanacea] gi|817597895|gb|AKF78455.1| ribosomal protein S12 (chloroplast) [Dunalia solanacea] Length = 129 Score = 68.9 bits (167), Expect = 5e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 938 NTRQSVKNVTKSPALRGCPQRRGTCTRVYVRLVQI 834 NTRQ ++NVTKSPALRGCPQRRGTCTRVYVRLV I Sbjct: 10 NTRQPIRNVTKSPALRGCPQRRGTCTRVYVRLVTI 44