BLASTX nr result
ID: Ziziphus21_contig00019445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019445 (290 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010093722.1| Disease resistance protein RPM1 [Morus notab... 56 9e-06 >ref|XP_010093722.1| Disease resistance protein RPM1 [Morus notabilis] gi|587864936|gb|EXB54528.1| Disease resistance protein RPM1 [Morus notabilis] Length = 941 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -2 Query: 160 MTEIILTSVIDKLVQLLIEEAQPFKGAHKEVMNLKNELELINSLFKDADTK 8 M+E LT VI+KLV+LL +E KG HKEV +LK+ELE++ KDA+ K Sbjct: 1 MSETFLTPVIEKLVELLADEVGLLKGVHKEVKSLKDELEILQPFLKDAEAK 51