BLASTX nr result
ID: Ziziphus21_contig00019390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019390 (329 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN44862.1| Cellulose synthase-like protein H1 [Glycine soja] 58 2e-06 ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H... 58 2e-06 >gb|KHN44862.1| Cellulose synthase-like protein H1 [Glycine soja] Length = 748 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 324 SAYMVLSYWPYVRGLFGKGKYGIPFSTKCKA 232 S Y+V+ YWPY +GLFG+GKYGIPFST CK+ Sbjct: 700 STYLVMCYWPYFKGLFGRGKYGIPFSTMCKS 730 >ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max] gi|947077919|gb|KRH26759.1| hypothetical protein GLYMA_12G192100 [Glycine max] Length = 748 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -3 Query: 324 SAYMVLSYWPYVRGLFGKGKYGIPFSTKCKA 232 S Y+V+ YWPY +GLFG+GKYGIPFST CK+ Sbjct: 700 STYLVMCYWPYFKGLFGRGKYGIPFSTMCKS 730