BLASTX nr result
ID: Ziziphus21_contig00019351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019351 (226 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010101740.1| Glutamate receptor 2.8 [Morus notabilis] gi|... 61 3e-07 >ref|XP_010101740.1| Glutamate receptor 2.8 [Morus notabilis] gi|587901215|gb|EXB89495.1| Glutamate receptor 2.8 [Morus notabilis] Length = 979 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 102 VIDFERWVGKLGLSSIEMALSDFYASHGYYYETR 1 V+D E WVGK+GLS IEMA+S+FYASHGYYY TR Sbjct: 71 VVDSETWVGKMGLSCIEMAVSEFYASHGYYYNTR 104