BLASTX nr result
ID: Ziziphus21_contig00019237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019237 (478 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 85 2e-14 ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 83 7e-14 gb|KJB23821.1| hypothetical protein B456_004G116300 [Gossypium r... 59 2e-06 tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea m... 57 4e-06 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] Length = 95 Score = 84.7 bits (208), Expect = 2e-14 Identities = 43/47 (91%), Positives = 43/47 (91%) Frame = +2 Query: 176 MAKLVDATDLIGLSLGMETYQVITFKFRETLEL*MGNPEPNPVF*KQ 316 MAKLVDATDLIGLSLGMETYQV TFKFRETLEL MGNPEPNP F KQ Sbjct: 1 MAKLVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 83.2 bits (204), Expect = 7e-14 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = +2 Query: 176 MAKLVDATDLIGLSLGMETYQVITFKFRETLEL*MGNPEPNPVF*KQ 316 MA+LVDATDLIGLSLGMETYQV TFKFRETLEL MGNPEPNP F KQ Sbjct: 1 MAELVDATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQ 47 >gb|KJB23821.1| hypothetical protein B456_004G116300 [Gossypium raimondii] Length = 34 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 202 LNWIEPWYGNLPSDNFQIQRNPGIINGQS 288 LNWIE WYGNL SDNFQIQRNPG+ NGQS Sbjct: 6 LNWIESWYGNLRSDNFQIQRNPGMKNGQS 34 >tpg|DAA62789.1| TPA: hypothetical protein ZEAMMB73_456670 [Zea mays] Length = 73 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = -3 Query: 305 KQDLAQDCPFIIPGFL*I*KLSLGRFPYQGSIQLSP 198 K+DLAQDCPF I GFL I KL L RFPYQGSIQ SP Sbjct: 38 KKDLAQDCPFFIRGFLGIWKLPLSRFPYQGSIQSSP 73