BLASTX nr result
ID: Ziziphus21_contig00019079
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019079 (281 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010109583.1| hypothetical protein L484_005241 [Morus nota... 60 5e-07 >ref|XP_010109583.1| hypothetical protein L484_005241 [Morus notabilis] gi|587936453|gb|EXC23292.1| hypothetical protein L484_005241 [Morus notabilis] Length = 193 Score = 60.5 bits (145), Expect = 5e-07 Identities = 37/60 (61%), Positives = 44/60 (73%) Frame = -1 Query: 281 VAVATAKGLGLAIRRQCLTSGRQISISEQLSTFAGGFLKISAVIFPVDALAPPPVKSYSY 102 V+VAT++GLG AIR LTS S +Q S+ AG L+IS+VIFPVDALAPPPVKS Y Sbjct: 10 VSVATSQGLGFAIRPNFLTSN---SSFDQFSSSAG-VLQISSVIFPVDALAPPPVKSDPY 65