BLASTX nr result
ID: Ziziphus21_contig00019037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019037 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012070732.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_012070732.1| PREDICTED: pentatricopeptide repeat-containing protein At4g04790, mitochondrial-like [Jatropha curcas] gi|643731858|gb|KDP39050.1| hypothetical protein JCGZ_00807 [Jatropha curcas] Length = 886 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 59 KNTYSAKKLLKQMEEADVKRDSLTYCYLLSNCESEDDIKKVLE 187 KN A +LK+M+EAD+K DS TYCYL++NCESED I K E Sbjct: 561 KNINGALTVLKRMKEADIKPDSQTYCYLITNCESEDQIIKYYE 603