BLASTX nr result
ID: Ziziphus21_contig00019027
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00019027 (359 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098489.1| hypothetical protein L484_025925 [Morus nota... 79 1e-12 emb|CDP12608.1| unnamed protein product [Coffea canephora] 57 4e-06 ref|XP_006448712.1| hypothetical protein CICLE_v10014274mg [Citr... 56 9e-06 >ref|XP_010098489.1| hypothetical protein L484_025925 [Morus notabilis] gi|587886344|gb|EXB75149.1| hypothetical protein L484_025925 [Morus notabilis] Length = 839 Score = 79.3 bits (194), Expect = 1e-12 Identities = 39/63 (61%), Positives = 48/63 (76%) Frame = -3 Query: 357 TAIGLKNAKRLKGYELYTKSGKSFAKHYGIKTSFDSSDQFSKVEMTGLSLLIGEPFKIVL 178 T IGLKNAKR+K Y+LYT SG++ K G++ SF SS QF VE++GL LLIGE FK+VL Sbjct: 777 TIIGLKNAKRVKEYKLYTNSGRNLIKSSGVRISFHSSGQFCTVELSGLPLLIGEEFKLVL 836 Query: 177 NLG 169 LG Sbjct: 837 TLG 839 >emb|CDP12608.1| unnamed protein product [Coffea canephora] Length = 905 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = -3 Query: 357 TAIGLKNAKRLKGYELYTKSGKSFAKHYGIKTSFDSSDQFSKVEMTGLSLLIGEPFKIVL 178 T +GL+N + LKGY++ T + + ++ GI +SF S QF+ VE++GL+ LI E FK+ L Sbjct: 842 TFLGLENVRALKGYQISTSNAQRRNQNAGISSSFKLSGQFASVEVSGLNTLIEEEFKLEL 901 Query: 177 NL 172 NL Sbjct: 902 NL 903 >ref|XP_006448712.1| hypothetical protein CICLE_v10014274mg [Citrus clementina] gi|557551323|gb|ESR61952.1| hypothetical protein CICLE_v10014274mg [Citrus clementina] Length = 829 Score = 56.2 bits (134), Expect = 9e-06 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 1/63 (1%) Frame = -3 Query: 357 TAIGLKNAKRLKGYELYTKSGKSFAKHYG-IKTSFDSSDQFSKVEMTGLSLLIGEPFKIV 181 T IGL+ KRLKGY+L T +G+ K+ IK S +S+ QF VE++ LSLLIGE FK+ Sbjct: 765 TFIGLEKFKRLKGYKLKTCTGRKLIKNSSVIKASVNSNAQFLTVEISKLSLLIGEEFKLD 824 Query: 180 LNL 172 L L Sbjct: 825 LEL 827