BLASTX nr result
ID: Ziziphus21_contig00018918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018918 (211 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010095606.1| D-amino acid dehydrogenase small subunit [Mo... 61 3e-07 >ref|XP_010095606.1| D-amino acid dehydrogenase small subunit [Morus notabilis] gi|587871927|gb|EXB61179.1| D-amino acid dehydrogenase small subunit [Morus notabilis] Length = 493 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -3 Query: 209 LGWKNKGSILTGRSPEELDVLKTSVTLLWDAGLRVEYLS 93 LGWKN GS+L GR+PEELDVLK V LL DAGLR EYLS Sbjct: 161 LGWKNTGSLLIGRTPEELDVLKRRVKLLSDAGLRSEYLS 199