BLASTX nr result
ID: Ziziphus21_contig00018753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018753 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008244171.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_009342043.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_008358457.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 63 1e-07 ref|XP_004308750.1| PREDICTED: pentatricopeptide repeat-containi... 61 4e-07 ref|XP_011025317.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_008360628.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 60 5e-07 ref|XP_002302689.2| hypothetical protein POPTR_0002s18390g [Popu... 60 5e-07 ref|XP_006386676.1| pentatricopeptide repeat-containing family p... 60 5e-07 ref|XP_009349964.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010107105.1| hypothetical protein L484_019583 [Morus nota... 59 1e-06 gb|KHN21919.1| Pentatricopeptide repeat-containing protein [Glyc... 59 2e-06 ref|XP_003539071.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_010263105.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-06 ref|XP_007132032.1| hypothetical protein PHAVU_011G061000g [Phas... 57 5e-06 ref|XP_010050229.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 emb|CBI27634.3| unnamed protein product [Vitis vinifera] 56 9e-06 ref|XP_003621545.1| pentatricopeptide (PPR) repeat protein [Medi... 56 9e-06 ref|XP_004491942.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_008244171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Prunus mume] Length = 638 Score = 63.5 bits (153), Expect = 6e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLDFLGKEI+KLRYQKASM+ NKDD Sbjct: 605 PNHVTDTTLDFLGKEIEKLRYQKASMVRNKDD 636 >ref|XP_009342043.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Pyrus x bretschneideri] Length = 538 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNHITDTTLDFLGKEI+K+RYQKASM+ NKDD Sbjct: 507 PNHITDTTLDFLGKEIEKMRYQKASMVRNKDD 538 >ref|XP_008358457.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g01570-like [Malus domestica] Length = 792 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLDFLGKEI+K+RYQKASM+ NKDD Sbjct: 761 PNHVTDTTLDFLGKEIEKMRYQKASMVRNKDD 792 >ref|XP_004308750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Fragaria vesca subsp. vesca] Length = 789 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDS 337 PNH+TDTTLDFLGKEI+K RYQKAS + NKDDS Sbjct: 757 PNHVTDTTLDFLGKEIEKSRYQKASFVRNKDDS 789 >ref|XP_011025317.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Populus euphratica] Length = 820 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDS 337 PNH+TDTTLDFL KEI+KLRYQKAS+M KDDS Sbjct: 787 PNHVTDTTLDFLAKEIEKLRYQKASIMRQKDDS 819 >ref|XP_008360628.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g01570-like [Malus domestica] Length = 774 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+ DTTLDFLGKEI+K+RYQKASM+ NKDD Sbjct: 743 PNHVIDTTLDFLGKEIEKMRYQKASMVRNKDD 774 >ref|XP_002302689.2| hypothetical protein POPTR_0002s18390g [Populus trichocarpa] gi|550345304|gb|EEE81962.2| hypothetical protein POPTR_0002s18390g [Populus trichocarpa] Length = 776 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDS 337 PNH+TDTTLDFL KEI+KLRYQKAS+M KDDS Sbjct: 743 PNHVTDTTLDFLAKEIEKLRYQKASIMRQKDDS 775 >ref|XP_006386676.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550345301|gb|ERP64473.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 776 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDS 337 PNH+TDTTLDFL KEI+KLRYQKAS+M KDDS Sbjct: 743 PNHVTDTTLDFLAKEIEKLRYQKASIMRQKDDS 775 >ref|XP_009349964.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Pyrus x bretschneideri] Length = 793 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 432 NHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 NH+TDTTLDFLGKEI+K+RYQKASM+ NKDD Sbjct: 763 NHVTDTTLDFLGKEIEKMRYQKASMVRNKDD 793 >ref|XP_010107105.1| hypothetical protein L484_019583 [Morus notabilis] gi|587926385|gb|EXC13626.1| hypothetical protein L484_019583 [Morus notabilis] Length = 788 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDSA 334 PNH+TDTTLDFLGKEI+K YQKAS+M NKDD + Sbjct: 755 PNHVTDTTLDFLGKEIEKESYQKASIMRNKDDDS 788 >gb|KHN21919.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 245 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLD+LG+EIDKLRYQ+AS++ KDD Sbjct: 212 PNHVTDTTLDYLGREIDKLRYQRASILSEKDD 243 >ref|XP_003539071.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570-like [Glycine max] gi|947080947|gb|KRH29736.1| hypothetical protein GLYMA_11G135300 [Glycine max] gi|947080948|gb|KRH29737.1| hypothetical protein GLYMA_11G135300 [Glycine max] Length = 768 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLD+LG+EIDKLRYQ+AS++ KDD Sbjct: 735 PNHVTDTTLDYLGREIDKLRYQRASILSEKDD 766 >ref|XP_010263105.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Nelumbo nucifera] gi|720022660|ref|XP_010263106.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Nelumbo nucifera] gi|720022664|ref|XP_010263107.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Nelumbo nucifera] gi|720022668|ref|XP_010263108.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Nelumbo nucifera] Length = 795 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDDSA 334 PNH+TDTTLDFL KEI+KLRYQKAS+ PN + A Sbjct: 761 PNHVTDTTLDFLEKEIEKLRYQKASIKPNNKEDA 794 >ref|XP_007132032.1| hypothetical protein PHAVU_011G061000g [Phaseolus vulgaris] gi|561005032|gb|ESW04026.1| hypothetical protein PHAVU_011G061000g [Phaseolus vulgaris] Length = 718 Score = 57.0 bits (136), Expect = 5e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLD+LG+EIDKLR+Q+AS++ KDD Sbjct: 685 PNHVTDTTLDYLGREIDKLRFQRASILSEKDD 716 >ref|XP_010050229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Eucalyptus grandis] gi|629123190|gb|KCW87615.1| hypothetical protein EUGRSUZ_A00015 [Eucalyptus grandis] Length = 801 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMM-PNKDDS 337 PNH+TDTTLDFLG+EI+KLRYQKASM+ ++DDS Sbjct: 767 PNHVTDTTLDFLGREIEKLRYQKASMVRMDRDDS 800 >emb|CBI27634.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMM-PNKDDSA 334 PNH+TDTTLDFLGKEI+KLRY+KAS++ +KDDS+ Sbjct: 321 PNHVTDTTLDFLGKEIEKLRYKKASIIRTSKDDSS 355 >ref|XP_003621545.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gi|87241489|gb|ABD33347.1| Pentatricopeptide repeat [Medicago truncatula] gi|355496560|gb|AES77763.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 791 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLD+L +EIDKLRYQKAS++ KDD Sbjct: 758 PNHVTDTTLDYLVREIDKLRYQKASILSKKDD 789 >ref|XP_004491942.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Cicer arietinum] Length = 793 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMMPNKDD 340 PNH+TDTTLD+L +EIDKLRYQKAS++ KDD Sbjct: 760 PNHVTDTTLDYLVREIDKLRYQKASILSEKDD 791 >ref|XP_002272556.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01570 [Vitis vinifera] Length = 792 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 1/35 (2%) Frame = -3 Query: 435 PNHITDTTLDFLGKEIDKLRYQKASMM-PNKDDSA 334 PNH+TDTTLDFLGKEI+KLRY+KAS++ +KDDS+ Sbjct: 758 PNHVTDTTLDFLGKEIEKLRYKKASIIRTSKDDSS 792