BLASTX nr result
ID: Ziziphus21_contig00018616
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00018616 (581 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494841.1| PREDICTED: uncharacterized protein LOC102608... 39 4e-06 >ref|XP_006494841.1| PREDICTED: uncharacterized protein LOC102608996 [Citrus sinensis] Length = 1923 Score = 39.3 bits (90), Expect(2) = 4e-06 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = +1 Query: 235 NLHFVRDKVTEKSLEVRYIPT*EQ 306 ++H++RDKV +K LEVRYIPT EQ Sbjct: 1151 DIHYIRDKVLQKQLEVRYIPTDEQ 1174 Score = 38.1 bits (87), Expect(2) = 4e-06 Identities = 19/47 (40%), Positives = 29/47 (61%), Gaps = 2/47 (4%) Frame = +2 Query: 101 NKIRWLQNLSQELQ--KIICPIV*SENIGAASLATKPVLHARAKHRE 235 ++I WL++L EL K+ P++ +N A LA PV H+R+KH E Sbjct: 1103 SEISWLESLFSELNIVKLPTPVLWCDNQSAGELAKNPVFHSRSKHIE 1149