BLASTX nr result
ID: Ziziphus21_contig00017416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00017416 (307 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531477.1| hydrolase, acting on glycosyl bonds, putativ... 57 7e-06 ref|XP_004489524.1| PREDICTED: endo-1,3(4)-beta-glucanase 1-like... 56 9e-06 >ref|XP_002531477.1| hydrolase, acting on glycosyl bonds, putative [Ricinus communis] gi|223528904|gb|EEF30901.1| hydrolase, acting on glycosyl bonds, putative [Ricinus communis] Length = 470 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/76 (38%), Positives = 38/76 (50%) Frame = -3 Query: 230 QVQSTVXXXXXXXXXXXXXXXXXPTNAFYQNFVIGNGDQPEYVHPYVVKXXXXXXXXXXX 51 +VQST PTN+F+QNF + NGDQPEY+HPYV+K Sbjct: 62 KVQSTALPDPSLFFAPSLLSSPLPTNSFFQNFTLKNGDQPEYIHPYVIKSSDSSLSISYP 121 Query: 50 XXXXNASLIYYILVPD 3 N+S +Y + VPD Sbjct: 122 SRFHNSSFLYQVFVPD 137 >ref|XP_004489524.1| PREDICTED: endo-1,3(4)-beta-glucanase 1-like [Cicer arietinum] Length = 658 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/52 (44%), Positives = 31/52 (59%) Frame = -3 Query: 158 TNAFYQNFVIGNGDQPEYVHPYVVKXXXXXXXXXXXXXXXNASLIYYILVPD 3 TN+F+QNFV+ NGDQPEY+HPY++K S +Y + VPD Sbjct: 36 TNSFFQNFVLQNGDQPEYIHPYLIKSSNSSLSFSYPLLLFTTSFLYQVFVPD 87