BLASTX nr result
ID: Ziziphus21_contig00017297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00017297 (276 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511288.1| hydrolase, hydrolyzing O-glycosyl compounds,... 75 1e-11 ref|XP_010045523.1| PREDICTED: probable galactinol--sucrose gala... 75 3e-11 gb|KCW83288.1| hypothetical protein EUGRSUZ_B00223 [Eucalyptus g... 75 3e-11 ref|XP_011071998.1| PREDICTED: probable galactinol--sucrose gala... 71 4e-10 ref|XP_007037795.1| Hydrolase, hydrolyzing O-glycosyl compounds,... 69 1e-09 ref|XP_011016709.1| PREDICTED: probable galactinol--sucrose gala... 68 2e-09 ref|XP_011005611.1| PREDICTED: probable galactinol--sucrose gala... 68 2e-09 ref|XP_013460984.1| raffinose synthase or seed inhibition protei... 68 2e-09 ref|XP_012470927.1| PREDICTED: probable galactinol--sucrose gala... 67 4e-09 ref|XP_012470926.1| PREDICTED: probable galactinol--sucrose gala... 67 4e-09 gb|KJB19525.1| hypothetical protein B456_003G107500 [Gossypium r... 67 4e-09 gb|KJB19524.1| hypothetical protein B456_003G107500 [Gossypium r... 67 4e-09 ref|XP_011072000.1| PREDICTED: probable galactinol--sucrose gala... 67 5e-09 gb|KDO61180.1| hypothetical protein CISIN_1g005843mg [Citrus sin... 67 5e-09 ref|XP_006493815.1| PREDICTED: probable galactinol--sucrose gala... 67 5e-09 ref|XP_006420906.1| hypothetical protein CICLE_v10004399mg [Citr... 67 5e-09 ref|XP_006848952.1| PREDICTED: probable galactinol--sucrose gala... 67 5e-09 ref|XP_002321648.1| hypothetical protein POPTR_0015s09800g [Popu... 67 7e-09 ref|XP_010102931.1| hypothetical protein L484_018950 [Morus nota... 66 9e-09 ref|XP_012079949.1| PREDICTED: probable galactinol--sucrose gala... 65 2e-08 >ref|XP_002511288.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] gi|223550403|gb|EEF51890.1| hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] Length = 685 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/61 (55%), Positives = 41/61 (67%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP A+ +P S LSS V PSDV+ LEE+A E WNGDCA+Y+F S Sbjct: 503 VFNCQGAGNWPMKLAAEETTPAASTPSPLSSHVRPSDVEFLEEVAGEDWNGDCAVYAFNS 562 Query: 96 G 94 G Sbjct: 563 G 563 >ref|XP_010045523.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Eucalyptus grandis] Length = 721 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQR G WPP GA Y P S ++S VSP DV+ L E+A E W GDCA+YS+ S Sbjct: 539 VFNCQRGGIWPPIRGAPYNPPSESEPFIISGIVSPRDVEFLGEVAGEDWLGDCAVYSYTS 598 Query: 96 G 94 G Sbjct: 599 G 599 >gb|KCW83288.1| hypothetical protein EUGRSUZ_B00223 [Eucalyptus grandis] Length = 758 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/61 (54%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQR G WPP GA Y P S ++S VSP DV+ L E+A E W GDCA+YS+ S Sbjct: 576 VFNCQRGGIWPPIRGAPYNPPSESEPFIISGIVSPRDVEFLGEVAGEDWLGDCAVYSYTS 635 Query: 96 G 94 G Sbjct: 636 G 636 >ref|XP_011071998.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Sesamum indicum] Length = 868 Score = 70.9 bits (172), Expect = 4e-10 Identities = 30/61 (49%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP G + S ++LS VSP DVD L+E+A E W+GDCA+Y+F + Sbjct: 686 VFNCQGAGNWPLRDGPERNPSSSSDSLILSGHVSPQDVDFLDEVAHETWSGDCAVYAFHT 745 Query: 96 G 94 G Sbjct: 746 G 746 >ref|XP_007037795.1| Hydrolase, hydrolyzing O-glycosyl compounds, putative [Theobroma cacao] gi|508775040|gb|EOY22296.1| Hydrolase, hydrolyzing O-glycosyl compounds, putative [Theobroma cacao] Length = 673 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/60 (55%), Positives = 40/60 (66%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQRAG WPP G+ Y GS + S VS D DSLEE+A E+W GDCA+Y+F S Sbjct: 538 VFNCQRAGVWPPVRGSIYYPVPGSGTPI-SGCVSALDADSLEEVAGENWRGDCAVYAFFS 596 >ref|XP_011016709.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2, partial [Populus euphratica] Length = 418 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG+WP A+ S + LS VSP DV+ L++IA E WNGDCA+Y+F S Sbjct: 236 VFNCQGAGRWPMKQEAEEIPAVPSGPLSLSGHVSPIDVEFLDDIAGEDWNGDCAVYAFNS 295 Query: 96 G 94 G Sbjct: 296 G 296 >ref|XP_011005611.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Populus euphratica] Length = 752 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/61 (50%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG+WP A+ S + LS VSP DV+ L++IA E WNGDCA+Y+F S Sbjct: 570 VFNCQGAGRWPMKQEAEEIPAVPSGPLSLSGHVSPIDVEFLDDIAGEDWNGDCAVYAFNS 629 Query: 96 G 94 G Sbjct: 630 G 630 >ref|XP_013460984.1| raffinose synthase or seed inhibition protein [Medicago truncatula] gi|657394353|gb|KEH35018.1| raffinose synthase or seed inhibition protein [Medicago truncatula] Length = 638 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/64 (46%), Positives = 40/64 (62%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP P + +S +V P DV+ LEE+A E+WNGDC LY+F + Sbjct: 572 VFNCQGAGSWPMKPS----EATPPTHLTISGKVKPLDVEFLEEVAGENWNGDCILYAFNA 627 Query: 96 GLKY 85 GLK+ Sbjct: 628 GLKF 631 >ref|XP_012470927.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 isoform X2 [Gossypium raimondii] Length = 1157 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQRAG WPP G+ Y GS + +S VS DVD+LEE+A E+W G CA+Y+ S Sbjct: 976 VFNCQRAGIWPPIKGSIYMPAPGSG-IPISGIVSAGDVDALEEVAGENWRGHCAVYACLS 1034 Query: 96 G 94 G Sbjct: 1035 G 1035 >ref|XP_012470926.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 isoform X1 [Gossypium raimondii] Length = 1197 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQRAG WPP G+ Y GS + +S VS DVD+LEE+A E+W G CA+Y+ S Sbjct: 1016 VFNCQRAGIWPPIKGSIYMPAPGSG-IPISGIVSAGDVDALEEVAGENWRGHCAVYACLS 1074 Query: 96 G 94 G Sbjct: 1075 G 1075 >gb|KJB19525.1| hypothetical protein B456_003G107500 [Gossypium raimondii] Length = 734 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQRAG WPP G+ Y GS + +S VS DVD+LEE+A E+W G CA+Y+ S Sbjct: 553 VFNCQRAGIWPPIKGSIYMPAPGSG-IPISGIVSAGDVDALEEVAGENWRGHCAVYACLS 611 Query: 96 G 94 G Sbjct: 612 G 612 >gb|KJB19524.1| hypothetical protein B456_003G107500 [Gossypium raimondii] Length = 694 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/61 (52%), Positives = 41/61 (67%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQRAG WPP G+ Y GS + +S VS DVD+LEE+A E+W G CA+Y+ S Sbjct: 513 VFNCQRAGIWPPIKGSIYMPAPGSG-IPISGIVSAGDVDALEEVAGENWRGHCAVYACLS 571 Query: 96 G 94 G Sbjct: 572 G 572 >ref|XP_011072000.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Sesamum indicum] Length = 749 Score = 67.0 bits (162), Expect = 5e-09 Identities = 30/61 (49%), Positives = 39/61 (63%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP + A V +S RVSP DV+ LEEIA E W+G+CA+Y+F + Sbjct: 572 VFNCQGAGSWPMKQAPECNENSKPAAVSISGRVSPLDVEFLEEIAGETWDGECAVYAFNT 631 Query: 96 G 94 G Sbjct: 632 G 632 >gb|KDO61180.1| hypothetical protein CISIN_1g005843mg [Citrus sinensis] Length = 674 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP T + S Q + D ++S +VSP+DV+ LEE++ + W GDCA++SF + Sbjct: 494 VFNCQGAGSWPCTE--KESSVQENVDSVISGKVSPADVEYLEEVSGKQWTGDCAVFSFNT 551 Query: 96 G 94 G Sbjct: 552 G 552 >ref|XP_006493815.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2-like [Citrus sinensis] Length = 812 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP T + S Q + D ++S +VSP+DV+ LEE++ + W GDCA++SF + Sbjct: 632 VFNCQGAGSWPCTE--KESSVQENVDSVISGKVSPADVEYLEEVSGKQWTGDCAVFSFNT 689 Query: 96 G 94 G Sbjct: 690 G 690 >ref|XP_006420906.1| hypothetical protein CICLE_v10004399mg [Citrus clementina] gi|557522779|gb|ESR34146.1| hypothetical protein CICLE_v10004399mg [Citrus clementina] Length = 748 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP T + S Q + D ++S +VSP+DV+ LEE++ + W GDCA++SF + Sbjct: 568 VFNCQGAGSWPCTE--KESSVQENVDSVISGKVSPADVEYLEEVSGKQWTGDCAVFSFNT 625 Query: 96 G 94 G Sbjct: 626 G 626 >ref|XP_006848952.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 [Amborella trichopoda] gi|548852413|gb|ERN10533.1| hypothetical protein AMTR_s00166p00055580 [Amborella trichopoda] Length = 756 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/60 (55%), Positives = 41/60 (68%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP Q ES +LLSSRVSP +V+ LEE+A E+W GDCA+Y+F S Sbjct: 573 VFNCQGAGVWPCQEKIQMES---KPSLLLSSRVSPINVEFLEEVAGENWAGDCAVYAFNS 629 >ref|XP_002321648.1| hypothetical protein POPTR_0015s09800g [Populus trichocarpa] gi|222868644|gb|EEF05775.1| hypothetical protein POPTR_0015s09800g [Populus trichocarpa] Length = 752 Score = 66.6 bits (161), Expect = 7e-09 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP A+ S LS VSP DV+ L++IA E WNGDCA+Y+F S Sbjct: 570 VFNCQGAGSWPMKQEAEEIPTVPSGPSSLSGHVSPIDVEFLDDIAGEDWNGDCAIYAFNS 629 Query: 96 G 94 G Sbjct: 630 G 630 >ref|XP_010102931.1| hypothetical protein L484_018950 [Morus notabilis] gi|587906377|gb|EXB94449.1| hypothetical protein L484_018950 [Morus notabilis] Length = 752 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/61 (47%), Positives = 40/61 (65%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP + + S ++S V P+DV+ LE+IA E+WNGDCA+Y+F S Sbjct: 570 VFNCQGAGIWPLKQVVENIHCKSSTSSVISGHVKPNDVEFLEDIAGENWNGDCAVYAFNS 629 Query: 96 G 94 G Sbjct: 630 G 630 >ref|XP_012079949.1| PREDICTED: probable galactinol--sucrose galactosyltransferase 2 isoform X2 [Jatropha curcas] Length = 753 Score = 65.5 bits (158), Expect = 2e-08 Identities = 29/61 (47%), Positives = 38/61 (62%) Frame = -1 Query: 276 IFNCQRAGKWPPTPGAQYESPQGSADVLLSSRVSPSDVDSLEEIADEHWNGDCALYSFGS 97 +FNCQ AG WP + S + LS V +DV+ LEE+A E+WNGDCA+Y+F S Sbjct: 571 VFNCQGAGSWPMKLETEDMPIAASTPLFLSGHVRTTDVEFLEEVAGENWNGDCAIYAFNS 630 Query: 96 G 94 G Sbjct: 631 G 631