BLASTX nr result
ID: Ziziphus21_contig00017109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00017109 (556 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206537.1| hypothetical protein PRUPE_ppa019621mg [Prun... 69 1e-09 ref|XP_004302224.1| PREDICTED: uncharacterized protein LOC101309... 69 1e-09 ref|XP_010099887.1| hypothetical protein L484_020070 [Morus nota... 65 3e-08 ref|XP_009343101.1| PREDICTED: uncharacterized protein LOC103935... 57 6e-06 >ref|XP_007206537.1| hypothetical protein PRUPE_ppa019621mg [Prunus persica] gi|462402179|gb|EMJ07736.1| hypothetical protein PRUPE_ppa019621mg [Prunus persica] Length = 164 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/52 (61%), Positives = 40/52 (76%) Frame = -1 Query: 556 EDNVDRESSSGAHIRFHPCYYFNLAKLAVLKCLGLAPASENSSTPQRRKSKE 401 ED ++ E+ + H+ FHPCYYF LA+LA LKCLGL ASE+SSTPQR K +E Sbjct: 112 EDLLEMEAPTAFHLYFHPCYYFRLARLAFLKCLGLDFASESSSTPQRGKRRE 163 >ref|XP_004302224.1| PREDICTED: uncharacterized protein LOC101309065 [Fragaria vesca subsp. vesca] Length = 151 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -1 Query: 556 EDNVDRESSSGAHIRFHPCYYFNLAKLAVLKCLGLAPASENSSTPQRRKSKE 401 ED V+ E S+ +I HPCYYF LA++A LKCLGL P+ EN STPQR K KE Sbjct: 99 EDMVEMEDSATPNIYLHPCYYFRLARVAFLKCLGLDPSGENLSTPQRGKRKE 150 >ref|XP_010099887.1| hypothetical protein L484_020070 [Morus notabilis] gi|587892229|gb|EXB80816.1| hypothetical protein L484_020070 [Morus notabilis] Length = 161 Score = 64.7 bits (156), Expect = 3e-08 Identities = 33/55 (60%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = -1 Query: 556 EDNVDRES--SSGAHIRFHPCYYFNLAKLAVLKCLGLAPASENSSTPQRRKSKEQ 398 E N DRE ++G +I FHPCYY LA+ A LKCLGL ASENSS Q +K KEQ Sbjct: 107 EINADREDQYAAGINIYFHPCYYVRLARTAFLKCLGLDSASENSSNQQGKKKKEQ 161 >ref|XP_009343101.1| PREDICTED: uncharacterized protein LOC103935057 [Pyrus x bretschneideri] Length = 161 Score = 57.0 bits (136), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -1 Query: 535 SSSGAHIRFHPCYYFNLAKLAVLKCLGLAPASENSSTPQRRKSKE 401 +++ HI FHPCYYF +A+LA LKCLG SE SSTP+ KE Sbjct: 116 AAAATHIYFHPCYYFRMARLAFLKCLGFDSTSEYSSTPRGGNRKE 160