BLASTX nr result
ID: Ziziphus21_contig00016930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016930 (469 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096492.1| BTB/POZ domain-containing protein [Morus not... 80 6e-13 ref|XP_002525040.1| Root phototropism protein, putative [Ricinus... 80 6e-13 ref|XP_012848835.1| PREDICTED: BTB/POZ domain-containing protein... 79 1e-12 ref|XP_012848837.1| PREDICTED: BTB/POZ domain-containing protein... 79 1e-12 ref|XP_011095883.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-12 ref|XP_011095882.1| PREDICTED: BTB/POZ domain-containing protein... 79 2e-12 ref|XP_012451423.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_012451430.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_009374833.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_009374827.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_006467218.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_006467216.1| PREDICTED: BTB/POZ domain-containing protein... 78 2e-12 ref|XP_006449993.1| hypothetical protein CICLE_v10014681mg [Citr... 78 2e-12 ref|XP_011005754.1| PREDICTED: BTB/POZ domain-containing protein... 78 3e-12 ref|XP_011005734.1| PREDICTED: BTB/POZ domain-containing protein... 78 3e-12 ref|XP_010646238.1| PREDICTED: BTB/POZ domain-containing protein... 77 4e-12 ref|XP_010252837.1| PREDICTED: BTB/POZ domain-containing protein... 77 4e-12 ref|XP_010646247.1| PREDICTED: BTB/POZ domain-containing protein... 77 4e-12 ref|XP_007026408.1| Root phototropism protein, putative isoform ... 77 4e-12 ref|XP_007026407.1| Root phototropism protein, putative isoform ... 77 4e-12 >ref|XP_010096492.1| BTB/POZ domain-containing protein [Morus notabilis] gi|587875503|gb|EXB64612.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 794 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GTRPDTFYTEEA RT+ISDVP DLSIQINNI++LLHK Sbjct: 1 MKFMKIGTRPDTFYTEEAVRTLISDVPSDLSIQINNISYLLHK 43 >ref|XP_002525040.1| Root phototropism protein, putative [Ricinus communis] gi|223535702|gb|EEF37367.1| Root phototropism protein, putative [Ricinus communis] Length = 591 Score = 80.1 bits (196), Expect = 6e-13 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATR+VISD+P DL I+INNIN+LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRSVISDIPSDLVIRINNINYLLHK 43 >ref|XP_012848835.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Erythranthe guttatus] gi|848897499|ref|XP_012848836.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Erythranthe guttatus] Length = 571 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTVISDVP D++I+INN+ +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVISDVPSDVTIRINNVTYLLHK 43 >ref|XP_012848837.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Erythranthe guttatus] gi|604314932|gb|EYU27638.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata] gi|604314933|gb|EYU27639.1| hypothetical protein MIMGU_mgv1a003699mg [Erythranthe guttata] Length = 569 Score = 79.3 bits (194), Expect = 1e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTVISDVP D++I+INN+ +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVISDVPSDVTIRINNVTYLLHK 43 >ref|XP_011095883.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Sesamum indicum] Length = 529 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTV+SDVP DL++QIN++ +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVMSDVPSDLTVQINDVTYLLHK 43 >ref|XP_011095882.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Sesamum indicum] Length = 531 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTV+SDVP DL++QIN++ +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVMSDVPSDLTVQINDVTYLLHK 43 >ref|XP_012451423.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] gi|823237546|ref|XP_012451424.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] gi|823237548|ref|XP_012451425.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] gi|823237550|ref|XP_012451426.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] gi|823237552|ref|XP_012451428.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] gi|823237554|ref|XP_012451429.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Gossypium raimondii] Length = 569 Score = 78.2 bits (191), Expect = 2e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISD+P DL+I+INN+ FLLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNVCFLLHK 43 >ref|XP_012451430.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Gossypium raimondii] gi|763801545|gb|KJB68500.1| hypothetical protein B456_010G247500 [Gossypium raimondii] gi|763801546|gb|KJB68501.1| hypothetical protein B456_010G247500 [Gossypium raimondii] gi|763801548|gb|KJB68503.1| hypothetical protein B456_010G247500 [Gossypium raimondii] Length = 567 Score = 78.2 bits (191), Expect = 2e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISD+P DL+I+INN+ FLLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNVCFLLHK 43 >ref|XP_009374833.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Pyrus x bretschneideri] Length = 422 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISDVP D IQINNI++LLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDVPSDFVIQINNIHYLLHK 43 >ref|XP_009374827.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Pyrus x bretschneideri] gi|694399399|ref|XP_009374828.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Pyrus x bretschneideri] gi|694399401|ref|XP_009374829.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Pyrus x bretschneideri] gi|694399403|ref|XP_009374830.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Pyrus x bretschneideri] Length = 621 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISDVP D IQINNI++LLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDVPSDFVIQINNIHYLLHK 43 >ref|XP_006467218.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X3 [Citrus sinensis] gi|641859973|gb|KDO78663.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis] gi|641859974|gb|KDO78664.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis] gi|641859975|gb|KDO78665.1| hypothetical protein CISIN_1g007644mg [Citrus sinensis] Length = 595 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGT+PDTFYTEEATRTVISD P DL IQ+NNI +LLHK Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHK 43 >ref|XP_006467216.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Citrus sinensis] gi|568825703|ref|XP_006467217.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Citrus sinensis] Length = 597 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGT+PDTFYTEEATRTVISD P DL IQ+NNI +LLHK Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHK 43 >ref|XP_006449993.1| hypothetical protein CICLE_v10014681mg [Citrus clementina] gi|557552604|gb|ESR63233.1| hypothetical protein CICLE_v10014681mg [Citrus clementina] Length = 595 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGT+PDTFYTEEATRTVISD P DL IQ+NNI +LLHK Sbjct: 1 MKFMKLGTKPDTFYTEEATRTVISDAPSDLVIQVNNIRYLLHK 43 >ref|XP_011005754.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X2 [Populus euphratica] Length = 561 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATR+V+SD+P DL IQI+NIN+LLH+ Sbjct: 1 MKFMKLGTRPDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQ 43 >ref|XP_011005734.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923294|ref|XP_011005735.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923296|ref|XP_011005736.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923298|ref|XP_011005737.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923300|ref|XP_011005738.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923302|ref|XP_011005739.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923304|ref|XP_011005740.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923306|ref|XP_011005742.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923308|ref|XP_011005743.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923310|ref|XP_011005744.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923312|ref|XP_011005745.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923314|ref|XP_011005746.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923316|ref|XP_011005747.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923318|ref|XP_011005748.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923320|ref|XP_011005749.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923322|ref|XP_011005750.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923324|ref|XP_011005751.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923326|ref|XP_011005752.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] gi|743923328|ref|XP_011005753.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Populus euphratica] Length = 563 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATR+V+SD+P DL IQI+NIN+LLH+ Sbjct: 1 MKFMKLGTRPDTFYTEEATRSVVSDIPNDLVIQISNINYLLHQ 43 >ref|XP_010646238.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438244|ref|XP_010646240.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438246|ref|XP_010646241.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438248|ref|XP_010646242.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438250|ref|XP_010646243.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438252|ref|XP_010646244.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] gi|731438254|ref|XP_010646246.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X1 [Vitis vinifera] Length = 595 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTV SDVP DL I+INNI +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVSSDVPSDLVIRINNITYLLHK 43 >ref|XP_010252837.1| PREDICTED: BTB/POZ domain-containing protein At5g47800-like isoform X1 [Nelumbo nucifera] Length = 565 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATR+V SDVP DL IQINNI +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRSVSSDVPSDLIIQINNIKYLLHK 43 >ref|XP_010646247.1| PREDICTED: BTB/POZ domain-containing protein At5g47800 isoform X2 [Vitis vinifera] gi|297736700|emb|CBI25736.3| unnamed protein product [Vitis vinifera] Length = 593 Score = 77.4 bits (189), Expect = 4e-12 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMKLGTRPDTFYTEEATRTV SDVP DL I+INNI +LLHK Sbjct: 1 MKFMKLGTRPDTFYTEEATRTVSSDVPSDLVIRINNITYLLHK 43 >ref|XP_007026408.1| Root phototropism protein, putative isoform 2 [Theobroma cacao] gi|508781774|gb|EOY29030.1| Root phototropism protein, putative isoform 2 [Theobroma cacao] Length = 581 Score = 77.4 bits (189), Expect = 4e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISD+P DL+I+INNI +LLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHK 43 >ref|XP_007026407.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] gi|590627302|ref|XP_007026410.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] gi|508781773|gb|EOY29029.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] gi|508781776|gb|EOY29032.1| Root phototropism protein, putative isoform 1 [Theobroma cacao] Length = 579 Score = 77.4 bits (189), Expect = 4e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 129 MKFMKLGTRPDTFYTEEATRTVISDVPYDLSIQINNINFLLHK 1 MKFMK+GT+PDTFYTEEATRTVISD+P DL+I+INNI +LLHK Sbjct: 1 MKFMKIGTKPDTFYTEEATRTVISDIPSDLTIRINNICYLLHK 43