BLASTX nr result
ID: Ziziphus21_contig00016860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016860 (319 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008379827.1| PREDICTED: uncharacterized protein LOC103442... 68 2e-09 ref|XP_010108979.1| 26S proteasome non-ATPase regulatory subunit... 61 4e-07 >ref|XP_008379827.1| PREDICTED: uncharacterized protein LOC103442803 [Malus domestica] Length = 1094 Score = 68.2 bits (165), Expect = 2e-09 Identities = 37/74 (50%), Positives = 43/74 (58%), Gaps = 10/74 (13%) Frame = -2 Query: 318 SDLCSMKVVPIGSHGPATHMVLLPNPCRPHQVLHKLTMPC-SPHATSIGDGEDGN----- 157 S+LC++K VPIG G +HMVLLPNP R H + H MPC SP +T DG D Sbjct: 783 SNLCTIKHVPIGKLGSLSHMVLLPNPRRHHNLCHAFKMPCSSPFSTPTDDGGDSKCLHDI 842 Query: 156 ----SNDSKCLQDL 127 DSKCLQDL Sbjct: 843 SVEAGGDSKCLQDL 856 >ref|XP_010108979.1| 26S proteasome non-ATPase regulatory subunit 10 [Morus notabilis] gi|587933656|gb|EXC20619.1| 26S proteasome non-ATPase regulatory subunit 10 [Morus notabilis] Length = 1086 Score = 60.8 bits (146), Expect = 4e-07 Identities = 38/79 (48%), Positives = 46/79 (58%), Gaps = 14/79 (17%) Frame = -2 Query: 318 SDLCSMKVVPIGSHGPATHMVLLP-NPCRPHQVLHKLTMPCSPHAT-----------SIG 175 SDLCS KVVPIG GP+ HMVL P +P Q+ H+L +P +P +I Sbjct: 749 SDLCSTKVVPIGRGGPSNHMVLSPKHPTLQQQLRHRLKIPITPSGNIAIDDGGDSNKAID 808 Query: 174 DGEDGN-SNDSKC-LQDLT 124 DG D N SNDS C L+DLT Sbjct: 809 DGRDSNKSNDSVCILEDLT 827