BLASTX nr result
ID: Ziziphus21_contig00016773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016773 (291 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010108113.1| hypothetical protein L484_023201 [Morus nota... 81 3e-13 ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_007210066.1| hypothetical protein PRUPE_ppa021101mg [Prun... 77 5e-12 ref|XP_008238657.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 emb|CBI22140.3| unnamed protein product [Vitis vinifera] 75 2e-11 ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containi... 75 2e-11 ref|XP_006362924.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_004248284.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-10 ref|XP_010277362.1| PREDICTED: pentatricopeptide repeat-containi... 71 4e-10 gb|EPS61154.1| hypothetical protein M569_13643, partial [Genlise... 70 5e-10 ref|XP_008369504.1| PREDICTED: pentatricopeptide repeat-containi... 70 6e-10 ref|XP_009790583.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_009620944.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_009373354.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_008437157.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_011092070.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_004147606.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_012087236.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 gb|KDP25587.1| hypothetical protein JCGZ_20743 [Jatropha curcas] 64 3e-08 emb|CDP08215.1| unnamed protein product [Coffea canephora] 62 1e-07 >ref|XP_010108113.1| hypothetical protein L484_023201 [Morus notabilis] gi|587930736|gb|EXC17845.1| hypothetical protein L484_023201 [Morus notabilis] Length = 577 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY SLL+NIYASVERWDDAGR+R V+EKG TKIPGCSWMESV Sbjct: 535 GYSSLLANIYASVERWDDAGRLRGAVEEKGLTKIPGCSWMESV 577 >ref|XP_003635554.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] gi|296083555|emb|CBI23551.3| unnamed protein product [Vitis vinifera] Length = 580 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GYCSLLSNIYAS ERWDD R+RKV EKGF+KIPGCSWMES Sbjct: 538 GYCSLLSNIYASGERWDDVKRLRKVTKEKGFSKIPGCSWMES 579 >ref|XP_007210066.1| hypothetical protein PRUPE_ppa021101mg [Prunus persica] gi|462405801|gb|EMJ11265.1| hypothetical protein PRUPE_ppa021101mg [Prunus persica] Length = 578 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY +LL+NIYAS ERWDDA R+RKV+++KGFTKIPGCSWM+S+ Sbjct: 536 GYYALLANIYASTERWDDARRLRKVMEKKGFTKIPGCSWMQSI 578 >ref|XP_008238657.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Prunus mume] Length = 578 Score = 75.9 bits (185), Expect = 1e-11 Identities = 31/43 (72%), Positives = 40/43 (93%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY +LL+NIYAS ERWDDA ++RKV+++KGFTKIPGCSWM+S+ Sbjct: 536 GYYALLANIYASAERWDDARKLRKVMEKKGFTKIPGCSWMQSI 578 >emb|CBI22140.3| unnamed protein product [Vitis vinifera] Length = 428 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GY SLLSNIYAS ERWDD R+RKV EKGF+KIPGCSWMES Sbjct: 386 GYRSLLSNIYASGERWDDVKRLRKVTKEKGFSKIPGCSWMES 427 >ref|XP_002270938.2| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Vitis vinifera] Length = 580 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GY SLLSNIYAS ERWDD R+RKV EKGF+KIPGCSWMES Sbjct: 538 GYRSLLSNIYASGERWDDVKRLRKVTKEKGFSKIPGCSWMES 579 >ref|XP_006362924.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760-like [Solanum tuberosum] Length = 576 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY SLL+NIYAS RWDDA R+RK V+EKG+ K+PGCSWME V Sbjct: 532 GYLSLLANIYASSGRWDDAERLRKGVEEKGYNKLPGCSWMEEV 574 >ref|XP_004248284.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Solanum lycopersicum] Length = 577 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY SLL+NIYAS RWDDA R+RK V+EKG+ K+PGCSWME V Sbjct: 533 GYLSLLANIYASSGRWDDAERLRKGVEEKGYNKLPGCSWMEEV 575 >ref|XP_010277362.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Nelumbo nucifera] Length = 573 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GY SLL+NIYASV RWDDA R+RKV++EK TKIPGCSW ES Sbjct: 531 GYYSLLANIYASVGRWDDAKRLRKVMEEKRLTKIPGCSWTES 572 >gb|EPS61154.1| hypothetical protein M569_13643, partial [Genlisea aurea] Length = 563 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIYAS RWDDA R+RK V+EKG K+PGCSWME Sbjct: 523 GYHSLLANIYASAGRWDDANRLRKAVEEKGLVKLPGCSWME 563 >ref|XP_008369504.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Malus domestica] Length = 578 Score = 70.1 bits (170), Expect = 6e-10 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY +LL+NIYAS RWDD R+RKV+++KGF KIPGCSWM+S+ Sbjct: 536 GYYALLANIYASAARWDDERRLRKVMEKKGFAKIPGCSWMDSM 578 >ref|XP_009790583.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Nicotiana sylvestris] gi|698487929|ref|XP_009790584.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Nicotiana sylvestris] Length = 575 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIYAS RWDDA R+RK V+EKG+ K+PGCSWME Sbjct: 532 GYLSLLANIYASSGRWDDAERLRKGVEEKGYGKLPGCSWME 572 >ref|XP_009620944.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Nicotiana tomentosiformis] Length = 575 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIYAS RWDDA R+RK V+EKG+ K+PGCSWME Sbjct: 532 GYLSLLANIYASSGRWDDAERLRKGVEEKGYGKLPGCSWME 572 >ref|XP_009373354.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Pyrus x bretschneideri] Length = 578 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMESV 163 GY LL+NIYAS RWDD R+RKV+++KGF KIPGCSWM+S+ Sbjct: 536 GYYVLLANIYASAARWDDERRLRKVMEKKGFAKIPGCSWMDSM 578 >ref|XP_008437157.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Cucumis melo] Length = 580 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIY+S+ERWDDA RMRK + K F KI GCSWME Sbjct: 536 GYRSLLANIYSSMERWDDAKRMRKAMSNKVFAKISGCSWME 576 >ref|XP_011092070.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Sesamum indicum] Length = 580 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIYAS RWDDA R+R+ V+EKG KIPG SWME Sbjct: 534 GYHSLLANIYASAGRWDDAKRLRRSVEEKGLVKIPGSSWME 574 >ref|XP_004147606.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Cucumis sativus] gi|700195014|gb|KGN50191.1| hypothetical protein Csa_5G157980 [Cucumis sativus] Length = 580 Score = 64.7 bits (156), Expect = 3e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GY SLL+NIY+S+ERWDDA RMRK + K F KI GCSWME Sbjct: 536 GYRSLLANIYSSMERWDDAKRMRKAMGNKIFAKISGCSWME 576 >ref|XP_012087236.1| PREDICTED: pentatricopeptide repeat-containing protein At4g22760 [Jatropha curcas] Length = 575 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GY SLL+NIYASV RWDDA ++RKV+ E+ +IPGCSW ES Sbjct: 533 GYYSLLANIYASVGRWDDARKLRKVMKERKLARIPGCSWTES 574 >gb|KDP25587.1| hypothetical protein JCGZ_20743 [Jatropha curcas] Length = 482 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWMES 166 GY SLL+NIYASV RWDDA ++RKV+ E+ +IPGCSW ES Sbjct: 440 GYYSLLANIYASVGRWDDARKLRKVMKERKLARIPGCSWTES 481 >emb|CDP08215.1| unnamed protein product [Coffea canephora] Length = 579 Score = 62.4 bits (150), Expect = 1e-07 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -1 Query: 291 GYCSLLSNIYASVERWDDAGRMRKVVDEKGFTKIPGCSWME 169 GYCSLLS IY S +WD+A R+R+ ++E+ F K+PGCSW++ Sbjct: 535 GYCSLLSKIYVSSGKWDEATRLREAIEERSFNKVPGCSWIK 575