BLASTX nr result
ID: Ziziphus21_contig00016716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016716 (452 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516623.1| conserved hypothetical protein [Ricinus comm... 75 2e-11 ref|XP_010112424.1| hypothetical protein L484_006109 [Morus nota... 67 5e-09 gb|KRH04013.1| hypothetical protein GLYMA_17G134000 [Glycine max] 65 2e-08 ref|XP_010112425.1| hypothetical protein L484_006110 [Morus nota... 62 1e-07 >ref|XP_002516623.1| conserved hypothetical protein [Ricinus communis] gi|223544225|gb|EEF45747.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 74.7 bits (182), Expect = 2e-11 Identities = 39/66 (59%), Positives = 43/66 (65%) Frame = -1 Query: 254 DFIEMVNHFFYREREVIQNPLAPEPVEVPHVRHFEVPFTL*FLS*FGNIVRRGKGGCPFT 75 D MVNH+F REREVIQNPLAPE EVPH L + S FGNIVRR + GCP T Sbjct: 25 DLENMVNHYFNREREVIQNPLAPELAEVPHA-------DLIYFSKFGNIVRRRRSGCPLT 77 Query: 74 FRRWQK 57 F+ QK Sbjct: 78 FQNGQK 83 >ref|XP_010112424.1| hypothetical protein L484_006109 [Morus notabilis] gi|587947243|gb|EXC33545.1| hypothetical protein L484_006109 [Morus notabilis] Length = 64 Score = 67.0 bits (162), Expect = 5e-09 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -1 Query: 452 GKERTKARSSLAIHSEGGWGSTSFMTHGPSVSLG 351 GKE TKARSSLAIHSEG WGSTSFMTHGPSVSLG Sbjct: 31 GKEWTKARSSLAIHSEGEWGSTSFMTHGPSVSLG 64 >gb|KRH04013.1| hypothetical protein GLYMA_17G134000 [Glycine max] Length = 67 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -3 Query: 399 MGVNLFHDPWPQCVTWLAFLE*IE*GWFFDRETGELAVVETRFSD 265 MGVNLFHDPWP CVTWLAFLE I G ++ LAVVETRF D Sbjct: 1 MGVNLFHDPWPWCVTWLAFLEQIRVGCSIGKQGSWLAVVETRFLD 45 >ref|XP_010112425.1| hypothetical protein L484_006110 [Morus notabilis] gi|587947244|gb|EXC33546.1| hypothetical protein L484_006110 [Morus notabilis] Length = 201 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 257 MDFIEMVNHFFYREREVIQNPLAPEPVEVPH 165 MD EMVNHFF REREVIQNPLAPEPVEVPH Sbjct: 1 MDLFEMVNHFFKREREVIQNPLAPEPVEVPH 31