BLASTX nr result
ID: Ziziphus21_contig00016487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016487 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW79606.1| hypothetical protein EUGRSUZ_C00961, partial [Euc... 57 7e-06 >gb|KCW79606.1| hypothetical protein EUGRSUZ_C00961, partial [Eucalyptus grandis] Length = 335 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = -1 Query: 145 DRSESFNETAFDEWVDLAEXXXXXXXXXFYKELEQLGFTIFLLNGGGE 2 D SE F+E +FD WVDLAE YKEL+QLGFTIFLL G E Sbjct: 206 DASEVFDENSFDGWVDLAEAPALPSSFSLYKELQQLGFTIFLLTGRSE 253