BLASTX nr result
ID: Ziziphus21_contig00016344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016344 (296 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882... 66 9e-09 ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phas... 65 2e-08 gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna a... 60 6e-07 gb|AFP55593.1| hypothetical protein [Rosa rugosa] 57 5e-06 >ref|XP_010662916.1| PREDICTED: uncharacterized protein LOC104882244 [Vitis vinifera] Length = 33 Score = 66.2 bits (160), Expect = 9e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 238 MSNIPRSLTDSSLTLFKLAISASDPWPFSLVFL 140 MSN+PRSLTDSSLTLFKLAISASDPWPFS VFL Sbjct: 1 MSNVPRSLTDSSLTLFKLAISASDPWPFSFVFL 33 >ref|XP_007136494.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|561009581|gb|ESW08488.1| hypothetical protein PHAVU_009G050000g [Phaseolus vulgaris] gi|947105208|gb|KRH53591.1| hypothetical protein GLYMA_06G134100 [Glycine max] gi|947116043|gb|KRH64345.1| hypothetical protein GLYMA_04G231200 [Glycine max] Length = 33 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 238 MSNIPRSLTDSSLTLFKLAISASDPWPFSLVFL 140 MSNIPRSLTDSSLTLF LAIS+SDPWPFSLVFL Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSLVFL 33 >gb|KOM40648.1| hypothetical protein LR48_Vigan04g084600 [Vigna angularis] Length = 175 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -2 Query: 238 MSNIPRSLTDSSLTLFKLAISASDPWPFSLV 146 MSNIPRSLTDSSLTLF LAIS+SDPWPFSL+ Sbjct: 1 MSNIPRSLTDSSLTLFNLAISSSDPWPFSLL 31 >gb|AFP55593.1| hypothetical protein [Rosa rugosa] Length = 199 Score = 57.0 bits (136), Expect = 5e-06 Identities = 35/44 (79%), Positives = 36/44 (81%) Frame = +3 Query: 138 YKKTREKGQGSDAEIASLKRVREESVRDLGILLMIIEIQI*PTY 269 YKKT EKGQGS+AEIASLK VR ESVRDLGILLMI Q PTY Sbjct: 156 YKKT-EKGQGSEAEIASLKMVRAESVRDLGILLMINYDQQ-PTY 197